Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T79001
(Former ID: TTDR00992)
|
|||||
Target Name |
Bacterial Chorismate synthase (Bact aroC)
|
|||||
Synonyms |
aroC; Chorismate synthase; CS; 5enolpyruvylshikimate3phosphate phospholyase; 5-enolpyruvylshikimate-3-phosphate phospholyase
Click to Show/Hide
|
|||||
Gene Name |
Bact aroC
|
|||||
Target Type |
Literature-reported target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Bacterial infection [ICD-11: 1A00-1C4Z] | |||||
Function |
Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system. It uses NADPH to reduce FMN.
Click to Show/Hide
|
|||||
BioChemical Class |
Alpha-carbonic anhydrase
|
|||||
UniProt ID | ||||||
EC Number |
EC 4.2.3.5
|
|||||
Sequence |
MAGNTIGQLFRVTTFGESHGLALGCIVDGVPPGIPLTEADLQHDLDRRRPGTSRYTTQRR
EPDQVKILSGVFEGVTTGTSIGLLIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGLRDY RGGGRSSARETAMRVAAGAIAKKYLAEKFGIEIRGCLTQMGDIPLDIKDWSQVEQNPFFC PDPDKIDALDELMRALKKEGDSIGAKVTVVASGVPAGLGEPVFDRLDADIAHALMSINAV KGVEIGDGFDVVALRGSQNRDEITKDGFQSNHAGGILGGISSGQQIIAHMALKPTSSITV PGRTINRFGEEVEMITKGRHDPCVGIRAVPIAEAMLAIVLMDHLLRQRAQNADVKTDIPR W Click to Show/Hide
|
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
There is no similarity protein (E value < 0.005) for this target
|
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
Panther Pathway | [+] 1 Panther Pathways | + | ||||
1 | Chorismate biosynthesis |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | US patent application no. 2009,0048,155, Methods for preventing and treating tissue injury and sepsis associated with yersinia pestis infection. | |||||
REF 2 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018127) | |||||
REF 3 | DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-41. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.