Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T60693
(Former ID: TTDS00127)
|
|||||
Target Name |
Opioid receptor kappa (OPRK1)
|
|||||
Synonyms |
OPRK; Kappa-type opioid receptor; Kappa opioid receptor; KOR-1; KOR; K-OR-1
Click to Show/Hide
|
|||||
Gene Name |
OPRK1
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 3 Target-related Diseases | + | ||||
1 | Non-specific cutaneous vascular sympton [ICD-11: ME64] | |||||
2 | Pain [ICD-11: MG30-MG3Z] | |||||
3 | Pruritus [ICD-11: EC90] | |||||
Function |
Functions as receptor for various synthetic opioids and for the psychoactive diterpene salvinorin A. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling leads to the inhibition of adenylate cyclase activity. Inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Plays a role in the perception of pain. Plays a role in mediating reduced physical activity upon treatment with synthetic opioids. Plays a role in the regulation of salivation in response to synthetic opioids. May play a role in arousal and regulation of autonomic and neuroendocrine functions. G-protein coupled opioid receptor that functions as receptor for endogenous alpha-neoendorphins and dynorphins, but has low affinity for beta-endorphins.
Click to Show/Hide
|
|||||
BioChemical Class |
GPCR rhodopsin
|
|||||
UniProt ID | ||||||
Sequence |
MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI CIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVL IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRV RNTVQDPAYLRDIDGMNKPV Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
ADReCS ID | BADD_A05962 | |||||
HIT2.0 ID | T43DMF |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 5 Approved Drugs | + | ||||
1 | CHLOROXINE | Drug Info | Approved | Erythema | [2] | |
2 | Dezocine | Drug Info | Approved | Pain | [3] | |
3 | Difelikefalin | Drug Info | Approved | Pruritus | [4] | |
4 | Nalbuphine | Drug Info | Approved | Pain | [5], [6] | |
5 | Nalfurafine hcl | Drug Info | Approved | Uremic pruritus | [2] | |
Clinical Trial Drug(s) | [+] 14 Clinical Trial Drugs | + | ||||
1 | Asimadoline | Drug Info | Phase 3 | Diarrhea-predominant irritable bowel syndrome | [8] | |
2 | CR-845 | Drug Info | Phase 2/3 | Pain | [9] | |
3 | PHN-131 | Drug Info | Phase 2/3 | Pain | [10] | |
4 | Apadoline | Drug Info | Phase 2 | Pain | [14] | |
5 | CR-665 | Drug Info | Phase 2 | Pain | [15] | |
6 | Enadoline | Drug Info | Phase 2 | Pain | [16], [17] | |
7 | LY-2456302 | Drug Info | Phase 2 | Alcohol dependence | [18] | |
8 | Niravoline | Drug Info | Phase 2 | Pain | [19] | |
9 | TPM-1/Morphine | Drug Info | Phase 2 | Pain | [20] | |
10 | AIKO-150 | Drug Info | Phase 1 | Opioid dependence | [21] | |
11 | BRL-52656 | Drug Info | Phase 1 | Pain | [22] | |
12 | MCP-201 | Drug Info | Phase 1 | Pain | [23] | |
13 | PF-4455242 | Drug Info | Phase 1 | Bipolar disorder | [24] | |
14 | SALVINORIN A | Drug Info | Phase 1 | Cerebral vasospasm | [25], [26] | |
Discontinued Drug(s) | [+] 7 Discontinued Drugs | + | ||||
1 | ADL 10-0101 | Drug Info | Discontinued in Phase 2 | Pain | [27] | |
2 | E-2078 | Drug Info | Discontinued in Phase 2 | Pain | [28], [29] | |
3 | R-84760 | Drug Info | Discontinued in Phase 2 | Pain | [30] | |
4 | VP004 | Drug Info | Discontinued in Phase 1 | Substance use disorder | [31] | |
5 | GR-89696 | Drug Info | Terminated | Neurodegenerative disorder | [33], [34] | |
6 | GR-94839 | Drug Info | Terminated | Pain | [35] | |
7 | KT-95 | Drug Info | Terminated | Inflammatory bowel disease | [36] | |
Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
1 | LY-25582 | Drug Info | Preclinical | Obesity | [32] | |
Mode of Action | [+] 4 Modes of Action | + | ||||
Inhibitor | [+] 200 Inhibitor drugs | + | ||||
1 | CHLOROXINE | Drug Info | [37] | |||
2 | Nalfurafine hcl | Drug Info | [40] | |||
3 | TPM-1/Morphine | Drug Info | [49] | |||
4 | AIKO-150 | Drug Info | [50] | |||
5 | SALVINORIN A | Drug Info | [54] | |||
6 | CLIOQUINOL | Drug Info | [37] | |||
7 | LY-25582 | Drug Info | [59] | |||
8 | SB-213698 | Drug Info | [64] | |||
9 | (-)-cyclorphan | Drug Info | [65] | |||
10 | 1-(1,2-diphenylethyl)-4-phenylpiperidin-4-ol | Drug Info | [66] | |||
11 | 1-(2-ethoxy-1-phenylethyl)-4-phenylpiperidin-4-ol | Drug Info | [66] | |||
12 | 1-(dio-tolylmethyl)-4-phenylpiperidin-4-ol | Drug Info | [66] | |||
13 | 1-benzhydryl-4-(2-fluorophenyl)piperidin-4-ol | Drug Info | [67] | |||
14 | 1-benzhydryl-4-(2-methoxyphenyl)piperidin-4-ol | Drug Info | [67] | |||
15 | 1-benzhydryl-4-(3-fluorophenyl)piperidin-4-ol | Drug Info | [67] | |||
16 | 1-benzhydryl-4-(3-methoxyphenyl)piperidin-4-ol | Drug Info | [67] | |||
17 | 1-benzhydryl-4-(3-phenylpropyl)piperidin-4-ol | Drug Info | [67] | |||
18 | 1-benzhydryl-4-(4-bromophenyl)piperidin-4-ol | Drug Info | [67] | |||
19 | 1-benzhydryl-4-(4-fluorophenyl)piperidin-4-ol | Drug Info | [67] | |||
20 | 1-benzhydryl-4-(4-methoxyphenyl)piperidin-4-ol | Drug Info | [67] | |||
21 | 1-benzhydryl-4-(4-propylphenyl)piperidin-4-ol | Drug Info | [67] | |||
22 | 1-benzhydryl-4-(benzyloxy)-4-phenylpiperidine | Drug Info | [66] | |||
23 | 1-benzhydryl-4-(pyridin-2-yl)piperidin-4-ol | Drug Info | [67] | |||
24 | 1-benzhydryl-4-(thiophen-2-yl)piperidin-4-ol | Drug Info | [67] | |||
25 | 1-benzhydryl-4-butylpiperidin-4-ol | Drug Info | [67] | |||
26 | 1-benzhydryl-4-cyclohexylpiperidin-4-ol | Drug Info | [67] | |||
27 | 1-benzhydryl-4-ethoxy-4-phenylpiperidine | Drug Info | [66] | |||
28 | 1-benzhydryl-4-hexylpiperidin-4-ol | Drug Info | [67] | |||
29 | 1-benzhydryl-4-isopropylpiperidin-4-ol | Drug Info | [67] | |||
30 | 1-benzhydryl-4-m-tolylpiperidin-4-ol | Drug Info | [67] | |||
31 | 1-benzhydryl-4-methoxy-4-phenylpiperidine | Drug Info | [66] | |||
32 | 1-benzhydryl-4-o-tolylpiperidin-4-ol | Drug Info | [67] | |||
33 | 1-benzhydryl-4-p-tolylpiperidin-4-ol | Drug Info | [67] | |||
34 | 1-benzhydryl-4-phenylpiperidin-4-ol | Drug Info | [68] | |||
35 | 1-benzhydryl-4-tert-butylpiperidin-4-ol | Drug Info | [67] | |||
36 | 12-EPI-SALVINORIN A | Drug Info | [69] | |||
37 | 14-O-phenylpropylnaltrexone | Drug Info | [70] | |||
38 | 17-(Cyclopropylmethyl)-N-phenylmorphinan-3-amine | Drug Info | [71] | |||
39 | 17-methyl-4'-methyldihydromorphinone | Drug Info | [72] | |||
40 | 17-Methylmorphinan-3-yl 4-Iodophenyl Carbamate | Drug Info | [71] | |||
41 | 2-(2-methylquinolin-4-ylamino)-N-phenylacetamide | Drug Info | [73] | |||
42 | 2-Benzylaminomethyl-3-hydroxymorphinan | Drug Info | [71] | |||
43 | 2-EPI-2-THIOSALVINORIN A | Drug Info | [74] | |||
44 | 2-EPI-2-THIOSALVINORIN B | Drug Info | [74] | |||
45 | 2-Hydroxymethyl-3-hydroxymorphinan | Drug Info | [71] | |||
46 | 3-(1-benzylpiperidin-4-yl)-5-chloro-1H-indole | Drug Info | [75] | |||
47 | 3-(1-benzylpiperidin-4-yloxy)benzamide | Drug Info | [76] | |||
48 | 3-desoxy-3-carboxamidonaltrexone | Drug Info | [77] | |||
49 | 4-(4-((phenethylamino)methyl)phenoxy)benzamide | Drug Info | [79] | |||
50 | 4-(p-Tolyl)spiro[chromene-2,4'-piperidine] | Drug Info | [80] | |||
51 | 4-(Spiro[chromene-2,4'-piperidine]-4-yl)benzamide | Drug Info | [81] | |||
52 | 4-(Spiro[chromene-2,4'-piperidine]-4-yl)phenol | Drug Info | [80] | |||
53 | 4-phenyl-1-(1-phenylbutyl)piperidin-4-ol | Drug Info | [66] | |||
54 | 4-phenyl-1-(1-phenylethyl)piperidin-4-ol | Drug Info | [66] | |||
55 | 4-phenyl-1-(1-phenylheptyl)piperidin-4-ol | Drug Info | [66] | |||
56 | 4-phenyl-1-(1-phenylhexyl)piperidin-4-ol | Drug Info | [66] | |||
57 | 4-phenyl-1-(1-phenylpentyl)piperidin-4-ol | Drug Info | [66] | |||
58 | 4-phenyl-1-(1-phenylpropyl)piperidin-4-ol | Drug Info | [66] | |||
59 | 4-phenyl-1-(phenyl(m-tolyl)methyl)piperidin-4-ol | Drug Info | [66] | |||
60 | 4-phenyl-1-(phenyl(o-tolyl)methyl)piperidin-4-ol | Drug Info | [66] | |||
61 | 4-phenyl-4-[1H-imidazol-2-yl]-piperidine | Drug Info | [82] | |||
62 | 4-Phenylspiro[chromene-2,4'-piperidine] | Drug Info | [80] | |||
63 | 5-(4-((phenethylamino)methyl)phenoxy)picolinamide | Drug Info | [79] | |||
64 | 6-(4-((phenethylamino)methyl)phenoxy)nicotinamide | Drug Info | [83] | |||
65 | 6-(4-(2-(benzylamino)ethyl)phenoxy)nicotinamide | Drug Info | [83] | |||
66 | 6-(4-(3-(benzylamino)propyl)phenoxy)nicotinamide | Drug Info | [79] | |||
67 | 6-(Allyl-methyl-amino)-4,4-diphenyl-heptan-3-ol | Drug Info | [84] | |||
68 | 6-desoxonaltrexone | Drug Info | [77] | |||
69 | 6beta-naltrexol HCl | Drug Info | [85] | |||
70 | 8-azabicyclo[3.2.1]octan-3-yloxy-benzamide | Drug Info | [86] | |||
71 | 8-carboxamidocyclazocine | Drug Info | [87] | |||
72 | ANISOCOUMARIN H | Drug Info | [88] | |||
73 | Bis-((-)-N-propargylmorphinan-3-yl) sebacoylate | Drug Info | [65] | |||
74 | BUTORPHAN | Drug Info | [92] | |||
75 | Cis-H-Tyr-c[D-AllylGly-Gly-Phe-D-Allylgly]-OH | Drug Info | [93] | |||
76 | Clocinnamox | Drug Info | [70] | |||
77 | CYCLAZOCINE | Drug Info | [92] | |||
78 | CYCLORPHAN | Drug Info | [92] | |||
79 | C[L-Ala-D-pro-L-Phe-D-trp] | Drug Info | [94] | |||
80 | C[L-mTyr-D-pro-L-Phe-D-trp] | Drug Info | [94] | |||
81 | C[L-Phe-D-pro-L-Phe-D-trp] | Drug Info | [94] | |||
82 | C[L-Phe-D-pro-L-Phe-L-trp] | Drug Info | [94] | |||
83 | C[L-Phe-D-pro-L-Tyr(OMe)-D-trp] | Drug Info | [94] | |||
84 | C[L-Phe-D-pro-L-Tyr-D-trp] | Drug Info | [94] | |||
85 | C[L-Tyr(OMe)-D-pro-L-Phe-D-trp] | Drug Info | [94] | |||
86 | C[L-Tyr-D-pro-L-Phe-D-trp] | Drug Info | [94] | |||
87 | DAMGO | Drug Info | [95] | |||
88 | Dcp-c[D-Cys-Gly-Phe(pNO2)-D-Cys]NH2 | Drug Info | [96] | |||
89 | DEOXY SALVINORIN A | Drug Info | [97] | |||
90 | Deprotected cogener of M6G | Drug Info | [98] | |||
91 | Dhp-c[D-Cys-Gly-Phe(pNO2)-D-Cys]NH2 | Drug Info | [96] | |||
92 | Dimepheptanol | Drug Info | [84] | |||
93 | DM6S | Drug Info | [95] | |||
94 | Dmt-Pro-3,5Dmp-Phe-NH2 | Drug Info | [101] | |||
95 | Dmt-Pro-Dmt-Phe-NH2 | Drug Info | [101] | |||
96 | Dmt-Pro-Emp-Phe-NH2 | Drug Info | [101] | |||
97 | Dmt-Pro-Imp-Phe-NH2 | Drug Info | [101] | |||
98 | Dmt-Pro-Mmp-Phe-NH2 | Drug Info | [101] | |||
99 | Dmt-Pro-Phe-Phe-NH2 | Drug Info | [101] | |||
100 | Dmt-Pro-Tmp-Phe-NH2 | Drug Info | [101] | |||
101 | DPDPE | Drug Info | [102] | |||
102 | Dynorphin(1-8) | Drug Info | [105] | |||
103 | ELAEOCARPENINE | Drug Info | [106] | |||
104 | ENDOMORPHIN 2 | Drug Info | [107] | |||
105 | ENDOMORPHIN-1 | Drug Info | [107] | |||
106 | FALCARINDIOL | Drug Info | [88] | |||
107 | H-Cdp-ala-Gly-Phe-leu-OH | Drug Info | [112] | |||
108 | H-Cdp-Gly-Gly-Phe-Leu-OH | Drug Info | [112] | |||
109 | H-Cpa-Gly-Gly-Phe-Met-OH | Drug Info | [112] | |||
110 | H-Tyr-c[D-Allylgly-Gly-Phe-D-Allylgly]-OH | Drug Info | [93] | |||
111 | H-Tyr-c[D-Allylgly-Gly-Phe-D-Allylgly]NH2 | Drug Info | [113] | |||
112 | H-Tyr-c[D-Allylgly-Gly-Phe-L-Allylgly]NH2 | Drug Info | [113] | |||
113 | H-Tyr-Gly-Gly-Phe-Met-NH2 | Drug Info | [112] | |||
114 | HERKINORIN | Drug Info | [114] | |||
115 | ICI-199441 | Drug Info | [115] | |||
116 | KETOCYCLAZOCINE | Drug Info | [50] | |||
117 | KNT-62 | Drug Info | [40] | |||
118 | KNT-63 | Drug Info | [40] | |||
119 | LOFENTANIL | Drug Info | [117] | |||
120 | M3P6S | Drug Info | [95] | |||
121 | M3Pr6S | Drug Info | [95] | |||
122 | M6G thiosaccharide analogue | Drug Info | [98] | |||
123 | M6S | Drug Info | [95] | |||
124 | MC-CAM | Drug Info | [118] | |||
125 | MCL-117 | Drug Info | [65] | |||
126 | MCL-139 | Drug Info | [65] | |||
127 | MCL-144 | Drug Info | [119] | |||
128 | MCL-145 | Drug Info | [65] | |||
129 | MCL-147 | Drug Info | [120] | |||
130 | MCL-149 | Drug Info | [120] | |||
131 | MCL-153 | Drug Info | [121] | |||
132 | MCL-154 | Drug Info | [121] | |||
133 | MCL-182 | Drug Info | [120] | |||
134 | MCL-183 | Drug Info | [120] | |||
135 | MCL-428 | Drug Info | [122] | |||
136 | MCL-429 | Drug Info | [122] | |||
137 | MCL-431 | Drug Info | [122] | |||
138 | MCL-432 | Drug Info | [122] | |||
139 | MCL-433 | Drug Info | [122] | |||
140 | MCL-434 | Drug Info | [122] | |||
141 | MCL-435 | Drug Info | [122] | |||
142 | MCL-443 | Drug Info | [122] | |||
143 | MCL-445 | Drug Info | [120] | |||
144 | MCL-446 | Drug Info | [120] | |||
145 | MCL-447 | Drug Info | [120] | |||
146 | MCL-448 | Drug Info | [120] | |||
147 | MCL-449 | Drug Info | [122] | |||
148 | MCL-450 | Drug Info | [123] | |||
149 | MCL-451 | Drug Info | [123] | |||
150 | MCL-457 | Drug Info | [120] | |||
151 | MCL-458 | Drug Info | [120] | |||
152 | METAZOCINE | Drug Info | [50] | |||
153 | MK-1925 | Drug Info | [124] | |||
154 | Morphinan Cyclic Imine analogue | Drug Info | [125] | |||
155 | MR-1029 | Drug Info | [126] | |||
156 | MR-1526 | Drug Info | [126] | |||
157 | MR-2034 | Drug Info | [50] | |||
158 | MR-2266 | Drug Info | [126] | |||
159 | N,N-diallyl[D-Pro-10]Dyn A-(1-11) | Drug Info | [127] | |||
160 | N,N-dibenzyl[D-Pro-10]Dyn A-(1-11) | Drug Info | [127] | |||
161 | N,N-diCPM[D-Pro-10]Dyn A-(1-11) | Drug Info | [127] | |||
162 | N-(17-Methylmorphinan-3-yl)-N'-phenylurea | Drug Info | [71] | |||
163 | N-allyl[D-Pro-10]Dyn A-(1-11) | Drug Info | [127] | |||
164 | N-Benzyl-17-(cyclobutylmethyl)morphinan-3-amine | Drug Info | [71] | |||
165 | N-Benzyl-17-(cyclopropylmethyl)morphinan-3-amine | Drug Info | [71] | |||
166 | N-benzyl[D-Pro-10]Dyn A-(1-11) | Drug Info | [127] | |||
167 | N-CPM[D-Pro-10]Dyn A-(1-11) | Drug Info | [127] | |||
168 | N-isobutylnoroxymorphone | Drug Info | [128] | |||
169 | NalBzOH | Drug Info | [95] | |||
170 | Naltrexone-6-alpha-ol | Drug Info | [50] | |||
171 | NORBINALTORPHIMINE | Drug Info | [130] | |||
172 | O-DESMETHYL TRAMADOL | Drug Info | [50] | |||
173 | OXYMORPHINDOLE | Drug Info | [131] | |||
174 | PHENAZOCINE | Drug Info | [50] | |||
175 | RTI-5989-23 | Drug Info | [59] | |||
176 | RTI-5989-25 | Drug Info | [59] | |||
177 | Salvinicin A | Drug Info | [132] | |||
178 | SALVINICIN B | Drug Info | [132] | |||
179 | SALVINORIN B | Drug Info | [114] | |||
180 | Salvinorin B 1-ethoxyethyl ether | Drug Info | [133] | |||
181 | Salvinorin B 2,2,2-trifluoroethoxymethyl ether | Drug Info | [133] | |||
182 | Salvinorin B 2-fluoroethoxymethyl ether | Drug Info | [133] | |||
183 | Salvinorin B 2-methoxy-2-propyl ether | Drug Info | [133] | |||
184 | Salvinorin B 2-methoxyethoxymethyl ether | Drug Info | [133] | |||
185 | Salvinorin B benzyloxymethyl ether | Drug Info | [133] | |||
186 | Salvinorin B butoxymethyl ether | Drug Info | [133] | |||
187 | Salvinorin B ethoxymethyl ether | Drug Info | [133] | |||
188 | Salvinorin B fluoromethyl ether | Drug Info | [133] | |||
189 | Salvinorin B isopropoxymethyl ether | Drug Info | [133] | |||
190 | Salvinorin B methoxymethyl ether | Drug Info | [133] | |||
191 | Salvinorin B methylthiomethyl ether | Drug Info | [133] | |||
192 | Salvinorin B propoxymethyl ether | Drug Info | [133] | |||
193 | Salvinorin B tert-butoxymethyl ether | Drug Info | [133] | |||
194 | Salvinorin B tetrahydropyran-2-yl ether | Drug Info | [133] | |||
195 | SN-23 | Drug Info | [64] | |||
196 | SN-28 | Drug Info | [134] | |||
197 | SPIROINDANYLOXYMORPHONE | Drug Info | [135] | |||
198 | Trans-H-Tyr-c[D-AllylGly-Gly-Phe-D-Allylgly]-OH | Drug Info | [93] | |||
199 | ZYKLOPHIN | Drug Info | [138] | |||
200 | [Dcp1]Dyn A(1-11)-NH2 | Drug Info | [96] | |||
Antagonist | [+] 11 Antagonist drugs | + | ||||
1 | Dezocine | Drug Info | [1] | |||
2 | LY-2456302 | Drug Info | [46] | |||
3 | Beta-endorphin | Drug Info | [89] | |||
4 | Diprenorphine | Drug Info | [100] | |||
5 | Drug 7684380 | Drug Info | [103] | |||
6 | L-685,818 | Drug Info | [103] | |||
7 | naltriben | Drug Info | [63] | |||
8 | Nor-binaltorphimine dihydrochloride | Drug Info | [90] | |||
9 | quadazocine | Drug Info | [63] | |||
10 | [3H]diprenorphine | Drug Info | [139] | |||
11 | [U-13C]ascomycin | Drug Info | [140] | |||
Agonist | [+] 26 Agonist drugs | + | ||||
1 | Difelikefalin | Drug Info | [38] | |||
2 | Asimadoline | Drug Info | [8] | |||
3 | CR-845 | Drug Info | [41] | |||
4 | PHN-131 | Drug Info | [42] | |||
5 | Apadoline | Drug Info | [14] | |||
6 | Carfentanil | Drug Info | [43] | |||
7 | CR-665 | Drug Info | [44] | |||
8 | Enadoline | Drug Info | [17], [45] | |||
9 | BRL-52656 | Drug Info | [51] | |||
10 | MCP-201 | Drug Info | [52] | |||
11 | ADL 10-0101 | Drug Info | [55] | |||
12 | R-84760 | Drug Info | [57] | |||
13 | Fedotozine | Drug Info | [60] | |||
14 | 3-Methylthiofentanyl | Drug Info | [78] | |||
15 | BRL 52537 hydrochloride | Drug Info | [90] | |||
16 | BRL 52974 | Drug Info | [91] | |||
17 | Dihydromorphine | Drug Info | [99] | |||
18 | dynorphin B | Drug Info | [104] | |||
19 | ethyketazocine | Drug Info | [108] | |||
20 | ethylketocyclazocine | Drug Info | [63] | |||
21 | Nalorphine | Drug Info | [129] | |||
22 | normorphine | Drug Info | [63] | |||
23 | NRP290 | Drug Info | [63] | |||
24 | spiradoline | Drug Info | [104] | |||
25 | tifluadom | Drug Info | [108] | |||
26 | U50,488H | Drug Info | [136], [137] | |||
Modulator | [+] 12 Modulator drugs | + | ||||
1 | Nalbuphine | Drug Info | [39] | |||
2 | Niravoline | Drug Info | [47], [48] | |||
3 | PF-4455242 | Drug Info | [53] | |||
4 | E-2078 | Drug Info | [56] | |||
5 | GR-89696 | Drug Info | [61] | |||
6 | GR-94839 | Drug Info | [62] | |||
7 | KT-95 | Drug Info | [63] | |||
8 | GR-38414 | Drug Info | [109] | |||
9 | GR-45809 | Drug Info | [110] | |||
10 | GR-86014 | Drug Info | [111] | |||
11 | GR-91272 | Drug Info | [111] | |||
12 | ICI-204448 | Drug Info | [116] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Drug Binding Sites of Target | Top | |||||
---|---|---|---|---|---|---|
Ligand Name: Meclinertant | Ligand Info | |||||
Structure Description | CryoEM Structure of Inactive NTSR1 Bound to SR48692 and Nb6 | PDB:7UL2 | ||||
Method | Electron microscopy | Resolution | 2.40 Å | Mutation | No | [141] |
PDB Sequence |
IYSKVLVTAV
69 YLALFVVGTV79 GNTVTLFTLA89 RSTVHYHLGS107 LALSDLLTLL117 LAMPVELYNF 127 IWVHHPWAFG137 DAGCRGYYFL147 RDACTYATAL157 NVASLSVERY167 LAICHPFKAK 177 TLMSRSRTKK187 FISAIWLASA197 LLAVPMLFTM207 GEQNRSAHAG220 GLVCTPTIHT 230 ATVKVVIQVN240 TFMSFIFPMV250 VISVLYTLMI260 LRLKSVRLLS270 GSREKDRNLR 299 RITRLVLAVV309 IAFVVCWLPY319 HVRRLMFCYI329 SWTPFLYDFY342 HYFYMVTNAL 352 FYVSSTINPI362 LYNLVSANFR372 HIFLATL
|
|||||
|
||||||
Ligand Name: Cholesterol | Ligand Info | |||||
Structure Description | Crystal Structure of a nanobody-stabilized active state of the kappa-opioid receptor | PDB:6B73 | ||||
Method | X-ray diffraction | Resolution | 3.10 Å | Mutation | Yes | [142] |
PDB Sequence |
LGSISPAIPV
60 IITAVYSVVF70 VVGLVGNSLV80 MFVIIRYTKM90 KTATNIYIFN100 LALADALVTT 110 TMPFQSTVYL120 MNSWPFGDVL130 CKIVLSIDYY140 NMFTSIFTLT150 MMSVDRYIAV 160 CHPVKALDFR170 TPLKAKIINI180 CIWLLSSSVG190 ISAIVLGGTK200 VRDVIECSLQ 213 FPDDDYSWWD223 LFMKICVFIF233 AFVIPVLIII243 VCYTLMILRL253 KSVRSREKDR 267 NLRRITRLVL277 VVVAVFVVCW287 TPIHIFILVE297 ALGTSHSTAA308 LSSYYFCIAL 318 GYTNSSLNPI328 LYAFLDENFK338 R
|
|||||
|
||||||
Click to View More Binding Site Information of This Target with Different Ligands |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Biological Network Descriptors
of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.
The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information
(Front Pharmacol, 9, 1245, 2018;
Curr Opin Struct Biol. 44:134-142, 2017).
Human Similarity Proteins
Human Pathway Affiliation
Biological Network Descriptors
|
KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
---|---|---|---|
Neuroactive ligand-receptor interaction | hsa04080 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signaling molecules and interaction | Pathway Hierarchy |
Degree | 1 | Degree centrality | 1.07E-04 | Betweenness centrality | 0.00E+00 |
---|---|---|---|---|---|
Closeness centrality | 1.51E-01 | Radiality | 1.20E+01 | Clustering coefficient | 0.00E+00 |
Neighborhood connectivity | 2.00E+00 | Topological coefficient | 1.00E+00 | Eccentricity | 14 |
Download | Click to Download the Full PPI Network of This Target | ||||
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 1 KEGG Pathways | + | ||||
1 | Neuroactive ligand-receptor interaction | |||||
Panther Pathway | [+] 3 Panther Pathways | + | ||||
1 | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | |||||
2 | Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway | |||||
3 | Opioid prodynorphin pathway | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | Peptide ligand-binding receptors | |||||
2 | G alpha (i) signalling events | |||||
WikiPathways | [+] 4 WikiPathways | + | ||||
1 | GPCRs, Class A Rhodopsin-like | |||||
2 | Peptide GPCRs | |||||
3 | GPCR ligand binding | |||||
4 | GPCR downstream signaling |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Pharmacological profiles of opioid ligands at kappa opioid receptors. BMC Pharmacol. 2006 Jan 25;6:3. | |||||
REF 2 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 3 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. | |||||
REF 4 | FDA Approved Drug Products from FDA Official Website. 2021. Application Number: 214916. | |||||
REF 5 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1663). | |||||
REF 6 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 070692. | |||||
REF 7 | ClinicalTrials.gov (NCT05550532) A Randomized, Double-blind, Multicenter, Parallel-group, Placebo-controlled Study to Evaluate the Efficacy, Safety, and Tolerability of Aticaprant 10 mg as Adjunctive Therapy in Adult Participants With Major Depressive Disorder (MDD) With Moderate-to-severe Anhedonia and Inadequate Response to Current Antidepressant Therapy. U.S.National Institutes of Health. | |||||
REF 8 | Emerging drugs for irritable bowel syndrome. Expert Opin Emerg Drugs. 2006 May;11(2):293-313. | |||||
REF 9 | ClinicalTrials.gov (NCT02542384) A Study Evaluating the Overall Pain Relief and Safety of Intravenous (IV) CR845 in Patients Undergoing Abdominal Surgery. | |||||
REF 10 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800029095) | |||||
REF 11 | ClinicalTrials.gov (NCT04221230) Study in Major Depressive Disorder With BTRX-335140 vs Placebo. U.S. National Institutes of Health. | |||||
REF 12 | ClinicalTrials.gov (NCT04129619) A Double-Blind, Placebo-Controlled, Phase 2, Responsive Adaptive Randomization Study of ORP-101 in Patients With Irritable Bowel Syndrome With Diarrhea (IBS-D). U.S.National Institutes of Health. | |||||
REF 13 | Clinical pipeline report, company report or official report of Klus Pharma | |||||
REF 14 | Novel developments with selective, non-peptidic kappa-opioid receptor agonists. Expert Opin Investig Drugs. 1997 Oct;6(10):1351-68. | |||||
REF 15 | Effect of a kappa-opioid agonist, i.v. JNJ-38488502, on sensation of colonic distensions in healthy male volunteers. Neurogastroenterol Motil. 2009 Mar;21(3):281-90. | |||||
REF 16 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1646). | |||||
REF 17 | Enadoline, a selective kappa-opioid receptor agonist shows potent antihyperalgesic and antiallodynic actions in a rat model of surgical pain. Pain. 1999 Mar;80(1-2):383-9. | |||||
REF 18 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 19 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003260) | |||||
REF 20 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023017) | |||||
REF 21 | ClinicalTrials.gov (NCT00829777) Safety Study of Intravenous 6 Naltrexol (AIKO-150) in Opioid-Dependent Subjects. U.S. National Institutes of Health. | |||||
REF 22 | Opiate receptors within the blood-brain barrier mediate kappa agonist-induced water diuresis. J Pharmacol Exp Ther. 1993 Jul;266(1):164-71. | |||||
REF 23 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018011) | |||||
REF 24 | ClinicalTrials.gov (NCT00988949) Proof Of Mechanism Study To Determine Efficacy Of PF-04455242 In Blocking Spiradoline (PF-00345768) Stimulated Prolactin Release. U.S. National Institutes of Health. | |||||
REF 25 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 26 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 27 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011770) | |||||
REF 28 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1648). | |||||
REF 29 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003061) | |||||
REF 30 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005881) | |||||
REF 31 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025668) | |||||
REF 32 | Emerging drugs for obesity: linking novel biological mechanisms to pharmaceutical pipelines. Expert Opin Emerg Drugs. 2005 Aug;10(3):643-60. | |||||
REF 33 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1649). | |||||
REF 34 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003263) | |||||
REF 35 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003733) | |||||
REF 36 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007966) | |||||
REF 37 | In silico identification and biochemical evaluation of novel inhibitors of NRH:quinone oxidoreductase 2 (NQO2). Bioorg Med Chem Lett. 2010 Dec 15;20(24):7331-6. | |||||
REF 38 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 39 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | |||||
REF 40 | Drug design and synthesis of a novel kappa opioid receptor agonist with an oxabicyclo[2.2.2]octane skeleton and its pharmacology. Bioorg Med Chem Lett. 2010 Jan 1;20(1):121-4. | |||||
REF 41 | Peptide Kappa Opioid Receptor Ligands: Potential for Drug Development. AAPS J. 2009 June; 11(2): 312-322. | |||||
REF 42 | Nalbuphine: an autoradiographic opioid receptor binding profile in the central nervous system of an agonist/antagonist analgesic. J Pharmacol Exp Ther. 1988 Jan;244(1):391-402. | |||||
REF 43 | Wax PM, Becker CE, Curry SC: Unexpected gas casualties in Moscow: a medical toxicology perspective. Ann Emerg Med. 2003 May;41(5):700-5. | |||||
REF 44 | Analgesic efficacy of peripheral kappa-opioid receptor agonist CR665 compared to oxycodone in a multi-modal, multi-tissue experimental human pain model: selective effect on visceral pain. Anesthesiology. 2009 Sep;111(3):616-24. | |||||
REF 45 | Analysis of [3H]bremazocine binding in single and combinatorial opioid receptor knockout mice. Eur J Pharmacol. 2001 Mar 2;414(2-3):189-95. | |||||
REF 46 | LY2456302 is a novel, potent, orally-bioavailable small molecule kappa-selective antagonist with activity in animal models predictive of efficacy in mood and addictive disorders. Neuropharmacology. 2014 Feb;77:131-44. | |||||
REF 47 | Effect of niravoline (RU51599), a kappa-opioid receptor agonist, on tumour-origin brain oedema. Acta Neurochir (Wien). 1999;141(7):771-8. | |||||
REF 48 | Effects of niravoline (RU 51599), a selective kappa-opioid receptor agonist on intracranial pressure in gradually expanding extradural mass lesion. J Neurotrauma. 1998 Feb;15(2):117-24. | |||||
REF 49 | Molecular Mechanisms of Opioid Receptor-Dependent Signaling and Behavior. Anesthesiology. 2011 December; 115(6): 1363-1381. | |||||
REF 50 | Syntheses and opioid receptor binding properties of carboxamido-substituted opioids. Bioorg Med Chem Lett. 2009 Jan 1;19(1):203-8. | |||||
REF 51 | Kappa-opioid receptors behind the blood-brain barrier are involved in the anti-hypertensive effects of systemically administered kappa-agonists in the conscious spontaneously hypertensive rat. J Pharm Pharmacol. 1999 Nov;51(11):1251-6. | |||||
REF 52 | US patent application no. 6,924,288, Enantiomerically pure opioid diarylmethylpiperzine and methods of using same. | |||||
REF 53 | Design and discovery of a selective small molecule opioid antagonist (2-methyl-N-((2'-(pyrrolidin-1-ylsulfonyl)biphenyl-4-yl)methyl)propan-1-amine, PF-4455242). J Med Chem. 2011 Aug 25;54(16):5868-77. | |||||
REF 54 | Toward a structure-based model of salvinorin A recognition of the kappa-opioid receptor. J Med Chem. 2008 Mar 27;51(6):1824-30. | |||||
REF 55 | Analgesia from a peripherally active kappa-opioid receptor agonist in patients with chronic pancreatitis. Pain. 2003 Jan;101(1-2):89-95. | |||||
REF 56 | Systemic effects of E-2078, a stabilized dynorphin A(1-8) analog, in rhesus monkeys. Psychopharmacology (Berl). 1999 Apr;143(2):190-6. | |||||
REF 57 | Effects of R-84760, a selective kappa-opioid receptor agonist, on nociceptive reflex in isolated neonatal rat spinal cord. Eur J Pharmacol. 1998 Feb 19;343(2-3):171-7. | |||||
REF 58 | WO patent application no. 2007,0677,14, Treatment of sequelae of psychiatric disorders. | |||||
REF 59 | Investigation of the N-substituent conformation governing potency and mu receptor subtype-selectivity in (+)-(3R, 4R)-dimethyl-4-(3-hydroxyphenyl)p... J Med Chem. 1998 May 21;41(11):1980-90. | |||||
REF 60 | Irritable bowel syndrome neuropharmacology. A review of approved and investigational compounds. J Clin Gastroenterol. 2002 Jul;35(1 Suppl):S58-67. | |||||
REF 61 | [(11)C]-GR89696, a potent kappa opiate receptor radioligand; in vivo binding of the R and S enantiomers. Nucl Med Biol. 2002 Jan;29(1):47-53. | |||||
REF 62 | GR94839, a kappa-opioid agonist with limited access to the central nervous system, has antinociceptive activity. Br J Pharmacol. 1992 Aug;106(4):783-9. | |||||
REF 63 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 318). | |||||
REF 64 | Design and synthesis of novel delta opioid receptor agonists and their pharmacologies. Bioorg Med Chem Lett. 2009 May 15;19(10):2792-5. | |||||
REF 65 | Synthesis and preliminary in vitro investigation of bivalent ligands containing homo- and heterodimeric pharmacophores at mu, delta, and kappa opio... J Med Chem. 2006 Jan 12;49(1):256-62. | |||||
REF 66 | Bioorg Med Chem Lett. 2007 Jun 1;17(11):3023-7. Epub 2007 Mar 23.Synthesis and structure-activity relationships of 4-hydroxy-4-phenylpiperidines as nociceptin receptor ligands: Part 1. | |||||
REF 67 | Bioorg Med Chem Lett. 2007 Jun 1;17(11):3028-33. Epub 2007 Mar 21.Synthesis and structure-activity relationships of 4-hydroxy-4-phenylpiperidines as nociceptin receptor ligands: Part 2. | |||||
REF 68 | The discovery of tropane derivatives as nociceptin receptor ligands for the management of cough and anxiety. Bioorg Med Chem Lett. 2009 May 1;19(9):2519-23. | |||||
REF 69 | Modification of the furan ring of salvinorin A: identification of a selective partial agonist at the kappa opioid receptor. Bioorg Med Chem. 2009 Feb 1;17(3):1370-80. | |||||
REF 70 | 14 beta-O-cinnamoylnaltrexone and related dihydrocodeinones are mu opioid receptor partial agonists with predominant antagonist activity. J Med Chem. 2009 Mar 26;52(6):1553-7. | |||||
REF 71 | Synthesis and opioid receptor binding affinities of 2-substituted and 3-aminomorphinans: ligands for mu, kappa, and delta opioid receptors. J Med Chem. 2010 Jan 14;53(1):402-18. | |||||
REF 72 | Structural determinants of opioid activity in derivatives of 14-aminomorphinones: effect of substitution in the aromatic ring of cinnamoylaminomorp... J Med Chem. 2006 Aug 24;49(17):5333-8. | |||||
REF 73 | Synthesis and characterizations of novel quinoline derivatives having mixed ligand activities at the kappa and mu receptors: Potential therapeutic ... Bioorg Med Chem. 2009 Aug 15;17(16):5782-90. | |||||
REF 74 | Convenient synthesis and in vitro pharmacological activity of 2-thioanalogs of salvinorins A and B. Bioorg Med Chem Lett. 2007 Apr 15;17(8):2229-32. | |||||
REF 75 | 3-(4-Piperidinyl)indoles and 3-(4-piperidinyl)pyrrolo-[2,3-b]pyridines as ligands for the ORL-1 receptor. Bioorg Med Chem Lett. 2006 Jul 1;16(13):3524-8. | |||||
REF 76 | Discovery of 8-azabicyclo[3.2.1]octan-3-yloxy-benzamides as selective antagonists of the kappa opioid receptor. Part 1. Bioorg Med Chem Lett. 2010 Oct 1;20(19):5847-52. | |||||
REF 77 | Syntheses of novel high affinity ligands for opioid receptors. Bioorg Med Chem Lett. 2009 Apr 15;19(8):2289-94. | |||||
REF 78 | You HJ, Colpaert FC, Arendt-Nielsen L: The novel analgesic and high-efficacy 5-HT1A receptor agonist F 13640 inhibits nociceptive responses, wind-up, and after-discharges in spinal neurons and withdrawal reflexes. Exp Neurol. 2005 Jan;191(1):174-83. | |||||
REF 79 | Structure-activity relationship studies of carboxamido-biaryl ethers as opioid receptor antagonists (OpRAs). Part 1. Bioorg Med Chem Lett. 2007 Oct 1;17(19):5349-52. | |||||
REF 80 | Potent, orally bioavailable delta opioid receptor agonists for the treatment of pain: discovery of N,N-diethyl-4-(5-hydroxyspiro[chromene-2,4'-pipe... J Med Chem. 2008 Oct 9;51(19):5893-6. | |||||
REF 81 | Spirocyclic delta opioid receptor agonists for the treatment of pain: discovery of N,N-diethyl-3-hydroxy-4-(spiro[chromene-2,4'-piperidine]-4-yl) b... J Med Chem. 2009 Sep 24;52(18):5685-702. | |||||
REF 82 | 4-Phenyl-4-[1H-imidazol-2-yl]-piperidine derivatives, a novel class of selective delta-opioid agonists. Bioorg Med Chem Lett. 2006 Jan 1;16(1):146-9. | |||||
REF 83 | Structure activity relationship studies of carboxamido-biaryl ethers as opioid receptor antagonists (OpRAs). Part 2. Bioorg Med Chem Lett. 2007 Dec 15;17(24):6841-6. | |||||
REF 84 | Synthesis of analogues of acetylmethadol and methadol as potential narcotic antagonists. J Med Chem. 1981 Jul;24(7):903-6. | |||||
REF 85 | Design, synthesis, and characterization of 6beta-naltrexol analogs, and their selectivity for in vitro opioid receptor subtypes. Bioorg Med Chem Lett. 2009 May 15;19(10):2811-4. | |||||
REF 86 | SAR development of a series of 8-azabicyclo[3.2.1]octan-3-yloxy-benzamides as kappa opioid receptor antagonists. Part 2. Bioorg Med Chem Lett. 2010 Sep 15;20(18):5405-10. | |||||
REF 87 | Redefining the structure-activity relationships of 2,6-methano-3-benzazocines. Part 6: Opioid receptor binding properties of cyclic variants of 8-c... Bioorg Med Chem. 2008 May 15;16(10):5653-64. | |||||
REF 88 | Novel coumarin glycoside and phenethyl vanillate from Notopterygium forbesii and their binding affinities for opioid and dopamine receptors. Bioorg Med Chem. 2008 Mar 15;16(6):3218-23. | |||||
REF 89 | Beta-endorphin is a potent inhibitor of thymidine incorporation into DNA via mu- and kappa-opioid receptors in fetal rat brain cell aggregates in culture. J Neurochem. 1993 Feb;60(2):765-7. | |||||
REF 90 | Kappa-opioid receptor selectivity for ischemic neuroprotection with BRL 52537 in rats. Anesth Analg. 2003 Dec;97(6):1776-83. | |||||
REF 91 | The antitussive activity of delta-opioid receptor stimulation in guinea pigs. J Pharmacol Exp Ther. 2000 Feb;292(2):803-9. | |||||
REF 92 | Synthesis and opioid receptor affinity of morphinan and benzomorphan derivatives: mixed kappa agonists and mu agonists/antagonists as potential pha... J Med Chem. 2000 Jan 13;43(1):114-22. | |||||
REF 93 | Synthesis of stable and potent delta/mu opioid peptides: analogues of H-Tyr-c[D-Cys-Gly-Phe-D-Cys]-OH by ring-closing metathesis. J Med Chem. 2007 Jun 28;50(13):3138-42. | |||||
REF 94 | Nascent structure-activity relationship study of a diastereomeric series of kappa opioid receptor antagonists derived from CJ-15,208. Bioorg Med Chem Lett. 2009 Jul 1;19(13):3647-50. | |||||
REF 95 | Opiate receptor binding properties of morphine-, dihydromorphine-, and codeine 6-O-sulfate ester congeners. Bioorg Med Chem Lett. 2006 Aug 15;16(16):4291-5. | |||||
REF 96 | Replacement of the N-terminal tyrosine residue in opioid peptides with 3-(2,6-dimethyl-4-carbamoylphenyl)propanoic acid (Dcp) results in novel opio... J Med Chem. 2006 Aug 24;49(17):5382-5. | |||||
REF 97 | Synthesis and in vitro evaluation of salvinorin A analogues: effect of configuration at C(2) and substitution at C(18). Bioorg Med Chem Lett. 2006 Sep 1;16(17):4679-85. | |||||
REF 98 | Synthesis and in vitro biological evaluation of a carbon glycoside analogue of morphine-6-glucuronide. Bioorg Med Chem Lett. 2005 Mar 15;15(6):1583-6. | |||||
REF 99 | Opiate receptor binding properties of morphine-, dihydromorphine-, and codeine 6-O-sulfate ester congeners. Bioorg Med Chem Lett. 2006 Aug 15;16(16):4291-5. | |||||
REF 100 | [6-O-methyl-11C]Diprenorphine Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. | |||||
REF 101 | Bifunctional [2',6'-dimethyl-L-tyrosine1]endomorphin-2 analogues substituted at position 3 with alkylated phenylalanine derivatives yield potent mi... J Med Chem. 2007 Jun 14;50(12):2753-66. | |||||
REF 102 | Opioid agonist and antagonist activities of morphindoles related to naltrindole. J Med Chem. 1992 Nov 13;35(23):4325-9. | |||||
REF 103 | FK-506-binding protein: three-dimensional structure of the complex with the antagonist L-685,818. J Biol Chem. 1993 May 25;268(15):11335-9. | |||||
REF 104 | Cloning and functional comparison of kappa and delta opioid receptors from mouse brain. Proc Natl Acad Sci U S A. 1993 Jul 15;90(14):6736-40. | |||||
REF 105 | Peptides as receptor selectivity modulators of opiate pharmacophores. J Med Chem. 1986 Jul;29(7):1222-5. | |||||
REF 106 | Synthesis and evaluation of opioid receptor-binding affinity of elaeocarpenine and its analogs. Bioorg Med Chem Lett. 2010 Mar 1;20(5):1601-3. | |||||
REF 107 | Structure-activity study on the Phe side chain arrangement of endomorphins using conformationally constrained analogues. J Med Chem. 2004 Jan 29;47(3):735-43. | |||||
REF 108 | Activation of the cloned human kappa opioid receptor by agonists enhances [35S]GTPgammaS binding to membranes: determination of potencies and efficacies of ligands. J Pharmacol Exp Ther. 1997 Aug;282(2):676-84. | |||||
REF 109 | A series of novel, highly potent and selective agonists for the kappa-opioid receptor. Br J Pharmacol. 1990 Dec;101(4):944-8. | |||||
REF 110 | J. Med. Chem. 1993,36, 2075-2083 | |||||
REF 111 | Neuroprotective actions of GR89696, a highly potent and selective kappa-opioid receptor agonist. | |||||
REF 112 | Further studies of tyrosine surrogates in opioid receptor peptide ligands. Bioorg Med Chem Lett. 2007 May 1;17(9):2656-60. | |||||
REF 113 | Dicarba analogues of the cyclic enkephalin peptides H-Tyr-c[D-Cys-Gly-Phe-D(or L)-Cys]NH(2) retain high opioid activity. J Med Chem. 2007 Mar 22;50(6):1414-7. | |||||
REF 114 | Herkinorin analogues with differential beta-arrestin-2 interactions. J Med Chem. 2008 Apr 24;51(8):2421-31. | |||||
REF 115 | Arylacetamide-derived fluorescent probes: synthesis, biological evaluation, and direct fluorescent labeling of kappa opioid receptors in mouse micr... J Med Chem. 1996 Apr 12;39(8):1729-35. | |||||
REF 116 | ICI 204448: a kappa-opioid agonist with limited access to the CNS. | |||||
REF 117 | Potential affinity labels for the opiate receptor based on fentanyl and related compounds. J Med Chem. 1982 Aug;25(8):913-9. | |||||
REF 118 | 14beta-Arylpropiolylamino-17-cyclopropylmethyl-7,8-dihydronormorphinones and related opioids. Further examples of pseudoirreversible mu opioid rece... J Med Chem. 2009 Nov 12;52(21):6926-30. | |||||
REF 119 | Univalent and bivalent ligands of butorphan: characteristics of the linking chain determine the affinity and potency of such opioid ligands. J Med Chem. 2009 Dec 10;52(23):7389-96. | |||||
REF 120 | In-vitro investigation of oxazol and urea analogues of morphinan at opioid receptors. Bioorg Med Chem. 2007 Jun 15;15(12):4106-12. | |||||
REF 121 | Effect of linker substitution on the binding of butorphan univalent and bivalent ligands to opioid receptors. Bioorg Med Chem Lett. 2010 Mar 1;20(5):1507-9. | |||||
REF 122 | High-affinity carbamate analogues of morphinan at opioid receptors. Bioorg Med Chem Lett. 2007 Mar 15;17(6):1508-11. | |||||
REF 123 | New opioid designed multiple ligand from Dmt-Tic and morphinan pharmacophores. J Med Chem. 2006 Sep 7;49(18):5640-3. | |||||
REF 124 | Identification of MK-1925: a selective, orally active and brain-penetrable opioid receptor-like 1 (ORL1) antagonist. Bioorg Med Chem Lett. 2009 Aug 15;19(16):4729-32. | |||||
REF 125 | Morphinan cyclic imines and pyrrolidines containing a constrained phenyl group: High affinity opioid agonists, Bioorg. Med. Chem. Lett. 5(24):2969-2974 (1995). | |||||
REF 126 | Electrophilic gamma-lactone kappa-opioid receptor probes. Analogues of 2'-hydroxy-2-tetrahydrofurfuryl-5,9-dimethyl-6,7-benzomorphan diastereomers. J Med Chem. 1991 Aug;34(8):2438-44. | |||||
REF 127 | Synthesis and opioid activity of [D-Pro10]dynorphin A-(1-11) analogues with N-terminal alkyl substitution. J Med Chem. 1997 Aug 15;40(17):2733-9. | |||||
REF 128 | Synthesis of N-isobutylnoroxymorphone from naltrexone by a selective cyclopropane ring opening reaction. Bioorg Med Chem Lett. 2008 Sep 15;18(18):4978-81. | |||||
REF 129 | Apparent efficacy of kappa-opioid receptor ligands on serum prolactin levels in rhesus monkeys. Eur J Pharmacol. 1999 Nov 3;383(3):305-9. | |||||
REF 130 | Synthesis of pyrrolomorphinan derivatives as kappa opioid agonists. Bioorg Med Chem Lett. 2010 Sep 1;20(17):5035-8. | |||||
REF 131 | Ligand binding to nucleic acids and proteins: Does selectivity increase with strength Eur J Med Chem. 2008 Nov;43(11):2307-15. | |||||
REF 132 | Synthetic studies of neoclerodane diterpenes from Salvia divinorum: preparation and opioid receptor activity of salvinicin analogues. J Med Chem. 2007 Jul 26;50(15):3596-603. | |||||
REF 133 | Standard protecting groups create potent and selective kappa opioids: salvinorin B alkoxymethyl ethers. Bioorg Med Chem. 2008 Feb 1;16(3):1279-86. | |||||
REF 134 | Design and synthesis of KNT-127, a -opioid receptor agonist effective by systemic administration. Bioorg Med Chem Lett. 2010 Nov 1;20(21):6302-5. | |||||
REF 135 | Aerobic oxidation of indolomorphinan without the 4,5-epoxy bridge and subsequent rearrangement of the oxidation product to spiroindolinonyl-C-normo... Bioorg Med Chem. 2009 Aug 15;17(16):5983-8. | |||||
REF 136 | The selective kappa-opioid receptor agonist U50,488H attenuates voluntary ethanol intake in the rat. Behav Brain Res. 2001 May;120(2):137-46. | |||||
REF 137 | Effects of kappa- and mu-opioid receptor agonists on Ca2+ channels in neuroblastoma cells: involvement of the orphan opioid receptor. Eur J Pharmacol. 1999 Aug 27;379(2-3):191-8. | |||||
REF 138 | The effects of C-terminal modifications on the opioid activity of [N-benzylTyr(1)]dynorphin A-(1-11) analogues. J Med Chem. 2009 Nov 12;52(21):6814-21. | |||||
REF 139 | kappa-Opioid receptor in humans: cDNA and genomic cloning, chromosomal assignment, functional expression, pharmacology, and expression pattern in the central nervous system. Proc Natl Acad Sci U S A.1995 Jul 18;92(15):7006-10. | |||||
REF 140 | NMR studies of an FK-506 analog, [U-13C]ascomycin, bound to FK-506-binding protein. J Med Chem. 1992 Jun 26;35(13):2467-73. | |||||
REF 141 | Structure determination of inactive-state GPCRs with a universal nanobody. Nat Struct Mol Biol. 2022 Dec;29(12):1188-1195. | |||||
REF 142 | Structure of the Nanobody-Stabilized Active State of the Kappa Opioid Receptor. Cell. 2018 Jan 11;172(1-2):55-67.e15. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.