Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T75440
(Former ID: TTDS00454)
|
|||||
Target Name |
Translocator protein (TSPO)
|
|||||
Synonyms |
Peripheral-type benzodiazepine receptor; Peripheral benzodiazepine receptor; PKBS; PBR; Mitochondrial benzodiazepine receptor; MBR; BZRP
Click to Show/Hide
|
|||||
Gene Name |
TSPO
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 6 Target-related Diseases | + | ||||
1 | Anxiety disorder [ICD-11: 6B00-6B0Z] | |||||
2 | Epilepsy/seizure [ICD-11: 8A61-8A6Z] | |||||
3 | Insomnia [ICD-11: 7A00-7A0Z] | |||||
4 | Intentional self-harm [ICD-11: PC91] | |||||
5 | Mood/affect symptom [ICD-11: MB24] | |||||
6 | Tonus and reflex abnormality [ICD-11: MB47] | |||||
Function |
Promotes the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism, but its precise physiological role is controversial. It is apparently not required for steroid hormone biosynthesis. Was initially identified as peripheral-type benzodiazepine receptor; can also bind isoquinoline carboxamides. Can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme.
Click to Show/Hide
|
|||||
BioChemical Class |
Cholesterol/porphyrin uptake translocator
|
|||||
UniProt ID | ||||||
Sequence |
MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
ADReCS ID | BADD_A00167 ; BADD_A00264 ; BADD_A03955 ; BADD_A05517 | |||||
HIT2.0 ID | T67U3B |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 19 Approved Drugs | + | ||||
1 | Adinazolam | Drug Info | Approved | Anxiety disorder | [10] | |
2 | Alpidem | Drug Info | Approved | Anxiety disorder | [11] | |
3 | Alprazolam | Drug Info | Approved | Anxiety disorder | [12], [13] | |
4 | Chlordiazepoxide | Drug Info | Approved | Anxiety disorder | [14], [15] | |
5 | Chlormezanone | Drug Info | Approved | Anxiety disorder | [11], [16], [17] | |
6 | Cinolazepam | Drug Info | Approved | Muscle spasm | [18] | |
7 | Clorazepate | Drug Info | Approved | Anxiety disorder | [19], [20] | |
8 | Clotiazepam | Drug Info | Approved | Anxiety disorder | [21] | |
9 | Diazepam | Drug Info | Approved | Epilepsy | [22], [23] | |
10 | Estazolam | Drug Info | Approved | Insomnia | [24], [25] | |
11 | Eszopiclone | Drug Info | Approved | Insomnia | [26], [27] | |
12 | Fludiazepam | Drug Info | Approved | Anxiety disorder | [28] | |
13 | Flumazenil | Drug Info | Approved | Benzodiazepine overdose | [29], [30] | |
14 | Flurazepam | Drug Info | Approved | Insomnia | [31], [32] | |
15 | Lorazepam | Drug Info | Approved | Anxiety disorder | [33], [34] | |
16 | Oxazepam | Drug Info | Approved | Anxiety disorder | [35], [5] | |
17 | Prazepam | Drug Info | Approved | Anxiety disorder | [36], [37] | |
18 | Quazepam | Drug Info | Approved | Insomnia | [38], [39] | |
19 | Temazepam | Drug Info | Approved | Insomnia | [40], [41] | |
Clinical Trial Drug(s) | [+] 7 Clinical Trial Drugs | + | ||||
1 | 11C-PBR-28 | Drug Info | Phase 2 | Brain disease | [42] | |
2 | Dextofisopam | Drug Info | Phase 2 | Irritable bowel syndrome | [43] | |
3 | ONO-2952 | Drug Info | Phase 2 | Irritable bowel syndrome | [44] | |
4 | SSR-180575 | Drug Info | Phase 2 | Rheumatoid arthritis | [45] | |
5 | TLN-4601 | Drug Info | Phase 2 | Solid tumour/cancer | [46] | |
6 | 18F-FEDAA-1106 | Drug Info | Phase 1 | Alzheimer disease | [47] | |
7 | BAY-85-8102 | Drug Info | Phase 1 | Brain disease | [48] | |
Discontinued Drug(s) | [+] 9 Discontinued Drugs | + | ||||
1 | Ro-16-6028 | Drug Info | Discontinued in Phase 3 | Anxiety disorder | [49], [50] | |
2 | Emapunil | Drug Info | Discontinued in Phase 2 | Anxiety disorder | [51], [52] | |
3 | Lirequinil | Drug Info | Discontinued in Phase 2 | Anxiety disorder | [53] | |
4 | S-8510 | Drug Info | Discontinued in Phase 2 | Cognitive impairment | [54] | |
5 | TRO-40303 | Drug Info | Discontinued in Phase 2 | Lateral sclerosis | [55] | |
6 | Imepitoin | Drug Info | Discontinued in Phase 1 | Convulsion | [56] | |
7 | DAA-1097 | Drug Info | Terminated | Anxiety disorder | [58] | |
8 | Miltirone | Drug Info | Terminated | Anxiety disorder | [59] | |
9 | NS-2979 | Drug Info | Terminated | Pain | [60] | |
Mode of Action | [+] 7 Modes of Action | + | ||||
Agonist | [+] 17 Agonist drugs | + | ||||
1 | Adinazolam | Drug Info | [61] | |||
2 | Alprazolam | Drug Info | [1], [63] | |||
3 | Chlormezanone | Drug Info | [65] | |||
4 | Clotiazepam | Drug Info | [67] | |||
5 | Diazepam | Drug Info | [68], [69] | |||
6 | Estazolam | Drug Info | [70], [71] | |||
7 | Eszopiclone | Drug Info | [63], [72] | |||
8 | Fludiazepam | Drug Info | [73] | |||
9 | Oxazepam | Drug Info | [75] | |||
10 | Dextofisopam | Drug Info | [43] | |||
11 | BAY-85-8102 | Drug Info | [74] | |||
12 | Emapunil | Drug Info | [84] | |||
13 | Lirequinil | Drug Info | [85] | |||
14 | S-8510 | Drug Info | [11] | |||
15 | Imepitoin | Drug Info | [87] | |||
16 | DAA-1097 | Drug Info | [88] | |||
17 | Benzodiazepine | Drug Info | [74] | |||
Inhibitor | [+] 11 Inhibitor drugs | + | ||||
1 | Alpidem | Drug Info | [62] | |||
2 | SSR-180575 | Drug Info | [11], [78] | |||
3 | (R)PK-11195 | Drug Info | [92] | |||
4 | 4-Methoxy-5-phenyl-6-thia-10b-aza-benzo[e]azulene | Drug Info | [93] | |||
5 | 5-Phenyl-6-thia-10b-aza-benzo[e]azulen-4-one | Drug Info | [94] | |||
6 | 5-Phenyl-6-thia-10b-aza-benzo[e]azulene | Drug Info | [93] | |||
7 | 6-Thia-10b-aza-benzo[e]azulen-4-one | Drug Info | [94] | |||
8 | N,N-Diethyl-2-(2-phenyl-1H-indol-3-yl)-acetamide | Drug Info | [96] | |||
9 | N,N-Dihexyl-2-(2-phenyl-1H-indol-3-yl)-acetamide | Drug Info | [96] | |||
10 | N,N-Dimethyl-2-(2-phenyl-1H-indol-3-yl)-acetamide | Drug Info | [96] | |||
11 | N-Hexyl-2-(2-phenyl-1H-indol-3-yl)-acetamide | Drug Info | [96] | |||
Modulator | [+] 14 Modulator drugs | + | ||||
1 | Chlordiazepoxide | Drug Info | [64] | |||
2 | Clorazepate | Drug Info | [64] | |||
3 | Flurazepam | Drug Info | [64] | |||
4 | Lorazepam | Drug Info | [64] | |||
5 | Prazepam | Drug Info | [64] | |||
6 | Quazepam | Drug Info | [64] | |||
7 | Temazepam | Drug Info | [64] | |||
8 | TLN-4601 | Drug Info | [79] | |||
9 | 18F-FEDAA-1106 | Drug Info | [80] | |||
10 | Ro-16-6028 | Drug Info | [83] | |||
11 | TRO-40303 | Drug Info | [86] | |||
12 | Miltirone | Drug Info | [90] | |||
13 | NS-2979 | Drug Info | [91] | |||
14 | U-89854 | Drug Info | [74] | |||
Binder | [+] 6 Binder drugs | + | ||||
1 | Cinolazepam | Drug Info | [66] | |||
2 | 11C-PBR-28 | Drug Info | [76] | |||
3 | 11C-PBR-170 | Drug Info | [74] | |||
4 | FGIN-1-27 | Drug Info | [95] | |||
5 | Ro 5-4864 | Drug Info | [95], [97] | |||
6 | TGSC01AA(4) | Drug Info | [74] | |||
Antagonist | [+] 2 Antagonist drugs | + | ||||
1 | Flumazenil | Drug Info | [74] | |||
2 | ONO-2952 | Drug Info | [77] | |||
Ligand | [+] 83 Ligand drugs | + | ||||
1 | Aryl oxyanilide derivative 1 | Drug Info | [81] | |||
2 | Aryl oxyanilide derivative 2 | Drug Info | [81] | |||
3 | Aryl oxyanilide derivative 3 | Drug Info | [81] | |||
4 | Benzimidazolone acetamide derivative 1 | Drug Info | [81] | |||
5 | Benzimidazolone acetamide derivative 2 | Drug Info | [81] | |||
6 | Benzodiazepine derivative 1 | Drug Info | [81] | |||
7 | Benzothiazepine analog 2 | Drug Info | [81] | |||
8 | Benzothiazepine analog 3 | Drug Info | [81] | |||
9 | Benzothiazepine analog 5 | Drug Info | [81] | |||
10 | Benzothiazepine analog 6 | Drug Info | [81] | |||
11 | Benzothiazepine analog 7 | Drug Info | [81] | |||
12 | Benzothiazepine analog 8 | Drug Info | [81] | |||
13 | Benzothiazepine analog 9 | Drug Info | [81] | |||
14 | Benzoxazepine analog 1 | Drug Info | [81] | |||
15 | Bidentate pyrazolopyrimidine acetamide analog 2 | Drug Info | [81] | |||
16 | Bidentate pyrazolopyrimidine acetamide analog 3 | Drug Info | [81] | |||
17 | Imidazopyridine acetamide analog 1 | Drug Info | [81] | |||
18 | Imidazopyridine acetamide analog 2 | Drug Info | [81] | |||
19 | Imidazopyridine acetamide analog 3 | Drug Info | [81] | |||
20 | Imidazopyridine acetamide analog 4 | Drug Info | [81] | |||
21 | Imidazopyridine acetamide analog 6 | Drug Info | [81] | |||
22 | Imidazopyridine acetamide analog 7 | Drug Info | [81] | |||
23 | Imidazopyridine derivative 1 | Drug Info | [81] | |||
24 | Imidazopyridine derivative 2 | Drug Info | [81] | |||
25 | Imidazo[1,2-b]pyridazine acetamide derivative 1 | Drug Info | [81] | |||
26 | Imidazo[1,2-b]pyridazine acetamide derivative 2 | Drug Info | [81] | |||
27 | Imidazo[1,2-b]pyridazine acetamide derivative 3 | Drug Info | [81] | |||
28 | Imidazo[1,2-b]pyridazine acetamide derivative 4 | Drug Info | [81] | |||
29 | Imidazo[1,2-b]pyridazine acetamide derivative 5 | Drug Info | [81] | |||
30 | Imidazo[1,2-b]pyridazine acetamide derivative 6 | Drug Info | [81] | |||
31 | Imidazo[1,2-b]pyridazine acetamide derivative 7 | Drug Info | [81] | |||
32 | Indole-based analog 10 | Drug Info | [82] | |||
33 | Indole-based analog 5 | Drug Info | [82] | |||
34 | Indole-based analog 9 | Drug Info | [82] | |||
35 | Iodophenyl-N-methyl-N-fluoroalkyl-3-isoquinoline carboxamide derivative 1 | Drug Info | [81] | |||
36 | Iodophenyl-N-methyl-N-fluoroalkyl-3-isoquinoline carboxamide derivative 2 | Drug Info | [81] | |||
37 | Iodophenyl-N-methyl-N-fluoroalkyl-3-isoquinoline carboxamide derivative 3 | Drug Info | [81] | |||
38 | Isoquinoline carboxamide derivative 1 | Drug Info | [81] | |||
39 | Phenylpurine acetamide analog 1 | Drug Info | [81] | |||
40 | Phenylpurine acetamide analog 2 | Drug Info | [81] | |||
41 | PMID27599163-Compound-52 | Drug Info | [82] | |||
42 | PMID27599163-Compound-75 | Drug Info | [82] | |||
43 | PMID27599163-Compound-76 | Drug Info | [82] | |||
44 | PMID27599163-Compound-77 | Drug Info | [82] | |||
45 | PMID27599163-Compound-78 | Drug Info | [82] | |||
46 | PMID27599163-Compound-79 | Drug Info | [82] | |||
47 | PMID27599163-Compound-81 | Drug Info | [82] | |||
48 | PMID27599163-Compound-82 | Drug Info | [82] | |||
49 | PMID27607364-Compound-141 | Drug Info | [81] | |||
50 | PMID27607364-Compound-162 | Drug Info | [81] | |||
51 | PMID27607364-Compound-4 | Drug Info | [81] | |||
52 | PMID27607364-Compound-58 | Drug Info | [81] | |||
53 | PMID27607364-Compound-59 | Drug Info | [81] | |||
54 | PMID27607364-Compound-60 | Drug Info | [81] | |||
55 | PMID27607364-Compound-61 | Drug Info | [81] | |||
56 | PMID27607364-Compound-62 | Drug Info | [81] | |||
57 | PMID27607364-Compound-64 | Drug Info | [81] | |||
58 | PMID27607364-Compound-65 | Drug Info | [81] | |||
59 | Pyrazolopyrimidine acetamide analog 1 | Drug Info | [81] | |||
60 | Pyrazolopyrimidine acetamide analog 2 | Drug Info | [81] | |||
61 | Quinazoline derivative 2 | Drug Info | [81] | |||
62 | Quinazoline derivative 3 | Drug Info | [81] | |||
63 | Quinazoline derivative 4 | Drug Info | [81] | |||
64 | Quinazoline derivative 5 | Drug Info | [81] | |||
65 | Quinazoline derivative 6 | Drug Info | [81] | |||
66 | Quinazoline derivative 7 | Drug Info | [81] | |||
67 | Quinoline carboxamide derivative 4 | Drug Info | [81] | |||
68 | Quinoline carboxamide derivative 5 | Drug Info | [81] | |||
69 | Quinoline carboxamide derivative 6 | Drug Info | [81] | |||
70 | Quinoline carboxamide derivative 7 | Drug Info | [81] | |||
71 | Quinoline carboxamide derivative 8 | Drug Info | [81] | |||
72 | Quinoline carboxamide derivative 9 | Drug Info | [81] | |||
73 | Tricyclic indole compound 10 | Drug Info | [82] | |||
74 | Tricyclic indole compound 11 | Drug Info | [82] | |||
75 | Tricyclic indole compound 12 | Drug Info | [82] | |||
76 | Tricyclic indole compound 14 | Drug Info | [82] | |||
77 | Tricyclic indole compound 2 | Drug Info | [82] | |||
78 | Tricyclic indole compound 3 | Drug Info | [82] | |||
79 | Tricyclic indole compound 4 | Drug Info | [82] | |||
80 | Tricyclic indole compound 5 | Drug Info | [82] | |||
81 | Tricyclic indole compound 6 | Drug Info | [82] | |||
82 | Tricyclic indole compound 7 | Drug Info | [82] | |||
83 | Tricyclic indole compound 9 | Drug Info | [82] | |||
Suppressor | [+] 1 Suppressor drugs | + | ||||
1 | Ginkgolide B (GKB) | Drug Info | [89] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Tissue Distribution
of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues.
The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects
(Nat Rev Drug Discov, 20: 64-81, 2021).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Biological Network Descriptors
of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.
The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information
(Front Pharmacol, 9, 1245, 2018;
Curr Opin Struct Biol. 44:134-142, 2017).
Human Similarity Proteins
Human Tissue Distribution
Human Pathway Affiliation
Biological Network Descriptors
|
There is no similarity protein (E value < 0.005) for this target
|
Note:
If a protein has TS (tissue specficity) scores at least in one tissue >= 2.5, this protein is called tissue-enriched (including tissue-enriched-but-not-specific and tissue-specific). In the plots, the vertical lines are at thresholds 2.5 and 4.
|
KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
---|---|---|---|
Neuroactive ligand-receptor interaction | hsa04080 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signaling molecules and interaction | Pathway Hierarchy | ||
Cholesterol metabolism | hsa04979 | Affiliated Target |
![]() |
Class: Organismal Systems => Digestive system | Pathway Hierarchy |
Degree | 5 | Degree centrality | 5.37E-04 | Betweenness centrality | 4.34E-04 |
---|---|---|---|---|---|
Closeness centrality | 1.85E-01 | Radiality | 1.31E+01 | Clustering coefficient | 1.00E-01 |
Neighborhood connectivity | 8.00E+00 | Topological coefficient | 2.18E-01 | Eccentricity | 11 |
Download | Click to Download the Full PPI Network of This Target | ||||
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 2 KEGG Pathways | + | ||||
1 | Neuroactive ligand-receptor interaction | |||||
2 | HTLV-I infection |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation | ||||||
Target QSAR Model |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Comparison of five benzodiazepine-receptor agonists on buprenorphine-induced mu-opioid receptor regulation. J Pharmacol Sci. 2009 May;110(1):36-46. | |||||
REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4360). | |||||
REF 3 | Drug information of Flunitrazepam, 2008. eduDrugs. | |||||
REF 4 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7313). | |||||
REF 5 | What every dentist should know about the "z-sedatives". J Mass Dent Soc. 2007 Fall;56(3):44-5. | |||||
REF 6 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3342). | |||||
REF 7 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 075154. | |||||
REF 8 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7195). | |||||
REF 9 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 017736. | |||||
REF 10 | Drug information of Adinazolam, 2008. eduDrugs. | |||||
REF 11 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 12 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7111). | |||||
REF 13 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 074046. | |||||
REF 14 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3370). | |||||
REF 15 | Use of the accelerating rotarod for assessment of motor performance decrement induced by potential anticonvulsant compounds in nerve agent poisoning. Drug Chem Toxicol. 1992;15(3):177-201. | |||||
REF 16 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7323). | |||||
REF 17 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 011467. | |||||
REF 18 | Drug information of Cinolazepam, 2008. eduDrugs. | |||||
REF 19 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7548). | |||||
REF 20 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 071852. | |||||
REF 21 | Drug information of Clotiazepam, 2008. eduDrugs. | |||||
REF 22 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3364). | |||||
REF 23 | ClinicalTrials.gov (NCT01939093) Therapeutic Effect of Quetiapine on Methamphetamine-Induced Psychosis. U.S. National Institutes of Health. | |||||
REF 24 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7550). | |||||
REF 25 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 074818. | |||||
REF 26 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7429). | |||||
REF 27 | Emerging therapies for fibromyalgia. Expert Opin Emerg Drugs. 2008 Mar;13(1):53-62. | |||||
REF 28 | Drug information of Fludiazepam, 2008. eduDrugs. | |||||
REF 29 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4192). | |||||
REF 30 | ClinicalTrials.gov (NCT00997087) A Randomized, Double-Blind, Placebo-Controlled Trial of Flumazenil for the Treatment of Obsessive Compulsive Disorder. U.S. National Institutes of Health. | |||||
REF 31 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7188). | |||||
REF 32 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 070344. | |||||
REF 33 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5884). | |||||
REF 34 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 071117. | |||||
REF 35 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7253). | |||||
REF 36 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7275). | |||||
REF 37 | Drug information of Prazepam, 2008. eduDrugs. | |||||
REF 38 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7288). | |||||
REF 39 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 018708. | |||||
REF 40 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7300). | |||||
REF 41 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 070919. | |||||
REF 42 | ClinicalTrials.gov (NCT02513589) Molecular Imaging of Inflammation With 18F-PBR06 to Identify Unstable Carotid Plaques in Patients With Stroke. | |||||
REF 43 | Emerging drugs for irritable bowel syndrome. Expert Opin Emerg Drugs. 2006 May;11(2):293-313. | |||||
REF 44 | ClinicalTrials.gov (NCT01887002) Study to Evaluate the Effects of ONO-2952 on Pain Perception Produced by Rectal Distention in Female Subjects With Diarrhea-Predominant Irritable Bowel Syndrome (IBS-D). U.S. National Institutes of Health. | |||||
REF 45 | ClinicalTrials.gov (NCT00502515) Dose-effect of SSR180575 in Diabetic Neuropathy. U.S. National Institutes of Health. | |||||
REF 46 | ClinicalTrials.gov (NCT00730262) Efficacy Study of TLN-4601 in Patients With Recurring Glioblastoma Multiforme. U.S. National Institutes of Health. | |||||
REF 47 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031827) | |||||
REF 48 | ClinicalTrials.gov (NCT01009359) Evaluation of the Neuroinflammation Pattern of BAY85-8102 F-18, DPA-714 in Probable Alzheimers Disease Patients Versus Healthy Volunteers and Radiation Dosimetry of F18, DPA-714 in Healthy Volunteers. U.S. National Institutes of Health. | |||||
REF 49 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4146). | |||||
REF 50 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000640) | |||||
REF 51 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8704). | |||||
REF 52 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013611) | |||||
REF 53 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001968) | |||||
REF 54 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005238) | |||||
REF 55 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033814) | |||||
REF 56 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008368) | |||||
REF 57 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004060) | |||||
REF 58 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012540) | |||||
REF 59 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003466) | |||||
REF 60 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013494) | |||||
REF 61 | Effects of antidepressants and benzodiazepine treatments on the dendritic structure of CA3 pyramidal neurons after chronic stress. Eur J Pharmacol. 1999 Apr 29;371(2-3):113-22. | |||||
REF 62 | Anxiolytic-like effects of N,N-dialkyl-2-phenylindol-3-ylglyoxylamides by modulation of translocator protein promoting neurosteroid biosynthesis. J Med Chem. 2008 Sep 25;51(18):5798-806. | |||||
REF 63 | Glutamate- and GABA-based CNS therapeutics. Curr Opin Pharmacol. 2006 Feb;6(1):7-17. | |||||
REF 64 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | |||||
REF 65 | Successful treatment of anxiety with a single night-time dose of chlormezanone: double-blind comparison with diazepam. Curr Med Res Opin. 1982;8(1):33-8. | |||||
REF 66 | Short-term sleep laboratory studies with cinolazepam in situational insomnia induced by traffic noise. Int J Clin Pharmacol Res. 1987;7(5):407-18. | |||||
REF 67 | Effects of benzodiazepines and non-benzodiazepine compounds on the GABA-induced response in frog isolated sensory neurones. Br J Pharmacol. 1989 Nov;98(3):735-40. | |||||
REF 68 | Translocator protein (18 kDa) mediates the pro-growth effects of diazepam on Ehrlich tumor cells in vivo. Eur J Pharmacol. 2010 Jan 25;626(2-3):131-8. | |||||
REF 69 | The alpha5(H105R) mutation impairs alpha5 selective binding properties by altered positioning of the alpha5 subunit in GABAA receptors containing t... J Neurochem. 2009 Jul;110(1):244-54. | |||||
REF 70 | Design and synthesis of new 2-substituted-5-(2-benzylthiophenyl)-1,3,4-oxadiazoles as benzodiazepine receptor agonists. Bioorg Med Chem Lett. 2005 Jun 15;15(12):3126-9. | |||||
REF 71 | Design and synthesis of 4H-3-(2-phenoxy)phenyl-1,2,4-triazole derivatives as benzodiazepine receptor agonists. Bioorg Med Chem. 2003 Mar 6;11(5):769-73. | |||||
REF 72 | New hypnotics: perspectives from sleep physiology. Vertex. 2007 Jul-Aug;18(74):294-9. | |||||
REF 73 | Benzodiazepines and their metabolites: relationship between binding affinity to the benzodiazepine receptor and pharmacological activity. Life Sci. 1985 Jan 14;36(2):113-9. | |||||
REF 74 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2879). | |||||
REF 75 | Effects of the combination of metyrapone and oxazepam on cocaine and food self-administration in rats. Pharmacol Biochem Behav. 2008 Nov;91(1):181-9. | |||||
REF 76 | PET imaging with [11C]PBR28 can localize and quantify upregulated peripheral benzodiazepine receptors associated with cerebral ischemia in rat. Neurosci Lett. 2007 Jan 16;411(3):200-5. | |||||
REF 77 | Anti-stress effects of ONO-2952, a novel translocator protein 18 kDa antagonist, in rats. Neuropharmacology. 2015 Jul 17;99:51-66. | |||||
REF 78 | SSR180575 (7-chloro-N,N,5-trimethyl-4-oxo-3-phenyl-3,5-dihydro-4H-pyridazino[4,5-b]indole-1-acetamide), a peripheral benzodiazepine receptor ligand, promotes neuronal survival and repair. J PharmacolExp Ther. 2002 Jun;301(3):1067-78. | |||||
REF 79 | TLN-4601 peripheral benzodiazepine receptor (PBR/TSPO) binding properties do not mediate apoptosis but confer tumor-specific accumulation.Biochem Pharmacol.2010 Nov 15;80(10):1572-9. | |||||
REF 80 | Role of peripheral benzodiazepine receptors in mitochondrial, cellular, and cardiac damage induced by oxidative stress and ischemia-reperfusion. J Pharmacol Exp Ther. 2003 Sep;306(3):828-37. | |||||
REF 81 | Translocator protein (TSPO) ligands for the diagnosis or treatment of neurodegenerative diseases: a patent review (2010-2015; part 1).Expert Opin Ther Pat. 2016 Nov;26(11):1325-1351. | |||||
REF 82 | Translocator protein (TSPO) ligands for the diagnosis or treatment of neurodegenerative diseases: a patent review (2010 - 2015; part 2).Expert Opin Ther Pat. 2016 Nov;26(11):1353-1366. | |||||
REF 83 | Bretazenil, a benzodiazepine receptor partial agonist, as an adjunct in the prophylactic treatment of OP poisoning. J Appl Toxicol. 2001 Dec;21 Suppl 1:S115-9. | |||||
REF 84 | Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. | |||||
REF 85 | Pharmacokinetics and pharmacodynamics of Ro 41-3696, a novel nonbenzodiazepine hypnotic. J Clin Pharmacol. 1995 Aug;35(8):821-9. | |||||
REF 86 | Translation of TRO40303 from myocardial infarction models to demonstration of safety and tolerance in a randomized Phase I trial. J Transl Med. 2014; 12: 38. | |||||
REF 87 | The pharmacology of imepitoin: the first partial benzodiazepine receptor agonist developed for the treatment of epilepsy. CNS Drugs. 2014 Jan;28(1):29-43. | |||||
REF 88 | Neuropharmacological profile of peripheral benzodiazepine receptor agonists, DAA1097 and DAA1106. Life Sci. 1999;64(16):1455-64. | |||||
REF 89 | Drug-induced inhibition of the peripheral-type benzodiazepine receptor expression and cell proliferation in human breast cancer cells. Anticancer Res. 2000 Sep-Oct;20(5A):2835-47. | |||||
REF 90 | Miltirone, a central benzodiazepine receptor partial agonist from a Chinese medicinal herb Salvia miltiorrhiza. Neurosci Lett. 1991 Jun 24;127(2):237-41. | |||||
REF 91 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013494) | |||||
REF 92 | [18F]FMDAA1106 and [18F]FEDAA1106: two positron-emitter labeled ligands for peripheral benzodiazepine receptor (PBR). Bioorg Med Chem Lett. 2003 Jan 20;13(2):201-4. | |||||
REF 93 | A concerted study using binding measurements, X-ray structural data, and molecular modeling on the stereochemical features responsible for the affi... J Med Chem. 1995 Nov 10;38(23):4730-8. | |||||
REF 94 | Novel ligands specific for mitochondrial benzodiazepine receptors: 6-arylpyrrolo[2,1-d][1,5]benzothiazepine derivatives. Synthesis, structure-activ... J Med Chem. 1994 May 13;37(10):1427-38. | |||||
REF 95 | Specific ligands of the peripheral benzodiazepine receptor induce apoptosis and cell cycle arrest in human colorectal cancer cells. Br J Cancer. 2001 Nov 30;85(11):1771-80. | |||||
REF 96 | Chemistry, binding affinities, and behavioral properties of a new class of "antineophobic" mitochondrial DBI receptor complex (mDRC) ligands. J Med Chem. 1993 Oct 1;36(20):2908-20. | |||||
REF 97 | Antiproliferative and differentiating effects of benzodiazepine receptor ligands on B16 melanoma cells. Biochem Pharmacol. 1998 Oct 15;56(8):1029-34. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.