Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T92124
(Former ID: TTDC00219)
|
|||||
Target Name |
OX40L receptor (CD134)
|
|||||
Synonyms |
Tumor necrosis factor receptor superfamily member 4; TXGP1L; TAX transcriptionally-activated glycoprotein 1 receptor; CD134; ACT35 antigen
Click to Show/Hide
|
|||||
Gene Name |
TNFRSF4
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Atopic eczema [ICD-11: EA80] | |||||
Function |
Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity.
Click to Show/Hide
|
|||||
UniProt ID | ||||||
Sequence |
MCVGARRLGRGPCAALLLLGLGLSTVTGLHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQ
NTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYK PGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQ GPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAAILGLGLVLGLLGPLAILLALYLL RRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
HIT2.0 ID | T74G3Z |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 4 Clinical Trial Drugs | + | ||||
1 | GBR 830 | Drug Info | Phase 2 | Atopic dermatitis | [1] | |
2 | PF-04518600 | Drug Info | Phase 2 | Solid tumour/cancer | [4] | |
3 | INCAGN1949 | Drug Info | Phase 1/2 | Solid tumour/cancer | [5], [6] | |
4 | TRemelimumab + MEDI0562 | Drug Info | Phase 1 | Solid tumour/cancer | [5] | |
Mode of Action | [+] 2 Modes of Action | + | ||||
Antagonist | [+] 1 Antagonist drugs | + | ||||
1 | GBR 830 | Drug Info | [1] | |||
Agonist | [+] 3 Agonist drugs | + | ||||
1 | PF-04518600 | Drug Info | [5], [6] | |||
2 | INCAGN1949 | Drug Info | [5] | |||
3 | TRemelimumab + MEDI0562 | Drug Info | [5] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Biological Network Descriptors
of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.
The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information
(Front Pharmacol, 9, 1245, 2018;
Curr Opin Struct Biol. 44:134-142, 2017).
Human Similarity Proteins
Human Pathway Affiliation
Biological Network Descriptors
|
KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
---|---|---|---|
Cytokine-cytokine receptor interaction | hsa04060 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signaling molecules and interaction | Pathway Hierarchy |
Degree | 2 | Degree centrality | 2.15E-04 | Betweenness centrality | 2.02E-04 |
---|---|---|---|---|---|
Closeness centrality | 1.92E-01 | Radiality | 1.33E+01 | Clustering coefficient | 0.00E+00 |
Neighborhood connectivity | 1.70E+01 | Topological coefficient | 5.00E-01 | Eccentricity | 13 |
Download | Click to Download the Full PPI Network of This Target | ||||
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 1 KEGG Pathways | + | ||||
1 | Cytokine-cytokine receptor interaction | |||||
NetPath Pathway | [+] 2 NetPath Pathways | + | ||||
1 | IL2 Signaling Pathway | |||||
2 | Wnt Signaling Pathway | |||||
PID Pathway | [+] 2 PID Pathways | + | ||||
1 | Downstream signaling in naï | |||||
2 | ||||||
Reactome | [+] 1 Reactome Pathways | + | ||||
1 | TNFs bind their physiological receptors |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 2 | ClinicalTrials.gov (NCT05633355) A Phase 3, Open-label, 52-week Study to Assess the Safety, Tolerability, and Efficacy of Rocatinlimab (AMG 451) in Adolescent Subjects Aged >= 12 to < 18 Years With Moderate-to-severe Atopic Dermatitis (AD) (ROCKET-Orbit). U.S.National Institutes of Health. | |||||
REF 3 | ClinicalTrials.gov (NCT02923349) A Phase 1/2, Open-Label, Dose-Escalation, Safety Study of INCAGN01949 in Subjects With Advanced or Metastatic Solid Tumors. U.S. National Institutes of Health. | |||||
REF 4 | ClinicalTrials.gov (NCT03092856) Axitinib With or Without Anti-OX40 Antibody PF-04518600 in Treating Patients With Metastatic Kidney Cancer. U.S. National Institutes of Health. | |||||
REF 5 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 6 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 7 | ClinicalTrials.gov (NCT04215978) Safety and Preliminary Effectiveness of BGB-A445 in Combination With Tislelizumab in Participants With Advanced Solid Tumors. U.S. National Institutes of Health. | |||||
REF 8 | OX40 is a potent immune-stimulating target in late-stage cancer patients. Cancer Res. 2013 Dec 15;73(24):7189-98. | |||||
REF 9 | Clinical pipeline report, company report or official report of Takeda. | |||||
REF 10 | ClinicalTrials.gov (NCT04353102) A First-in-Human (FIH), Multicenter, Open-Label, Phase 1 Dose-Escalation Study to Evaluate the Safety, Tolerability, and Pharmacokinetics of YH002 in Subjects With Advanced Solid Malignancies. U.S.National Institutes of Health. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.