Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T86552
|
||||
Former ID |
TTDNC00502
|
||||
Target Name |
Tumour necrosis factor receptor-1 (TNFR1)
|
||||
Gene Name |
TNFRSF1A
|
||||
Synonyms |
CD120a; TBPI; TNF-R1; TNF-RI; TNFR-I; Tumor necrosis factor receptor 1; Tumor necrosis factor receptor type I; Tumor necrosis factor-binding protein 1; TNFRSF1A
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Arthritis [ICD9: 710-719; ICD10: M00-M25] | ||||
Acute lung injury [ICD9: 518; ICD10: J80] | |||||
Autoimmune diabetes [ICD10: E08-E13] | |||||
Alopecia [ICD9: 704.09; ICD10: L65.9] | |||||
Adult respiratory distress syndrome [ICD9: 518.5, 518.82; ICD10: J80] | |||||
Acute liver failure [ICD10: K72] | |||||
Chronic obstructive pulmonary disease [ICD9: 490-492, 494-496; ICD10: J40-J44, J47] | |||||
Glioblastoma multiforme [ICD9: 191; ICD10: C71] | |||||
Inflammatory bowel disease [ICD9: 555, 556; ICD10: K50, K51] | |||||
Multiple scierosis [ICD9: 340; ICD10: G35] | |||||
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
Function |
Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate- specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase. .
|
||||
BioChemical Class |
Cytokine receptor
|
||||
UniProt ID | |||||
Sequence |
MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCT
KCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVD RDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECV SCSNCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLSLLFIGLMYRYQRWK SKLYSIVCGKSTPEKEGELEGTTTKPLAPNPSFSPTPGFTPTLGFSPVPSSTFTSSSTYT PGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQSLDTDDPATLY AVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLEL LGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR |
||||
Drugs and Mode of Action | |||||
Drug(s) | Drug 2862277 | Drug Info | Phase 2 | Acute lung injury | [524882] |
VB-111 | Drug Info | Phase 2 | Glioblastoma multiforme | [531640] | |
AVX-470 | Drug Info | Phase 1 | Inflammatory bowel disease | [524174] | |
GSK1995057 | Drug Info | Phase 1 | Adult respiratory distress syndrome | [523888] | |
Anti-IFN gamma | Drug Info | Terminated | Alopecia | [546358] | |
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | MAPK signaling pathway | ||||
Cytokine-cytokine receptor interaction | |||||
NF-kappa B signaling pathway | |||||
Sphingolipid signaling pathway | |||||
Apoptosis | |||||
Osteoclast differentiation | |||||
TNF signaling pathway | |||||
Adipocytokine signaling pathway | |||||
Non-alcoholic fatty liver disease (NAFLD) | |||||
Alzheimer' | |||||
s disease | |||||
Amyotrophic lateral sclerosis (ALS) | |||||
Chagas disease (American trypanosomiasis) | |||||
Toxoplasmosis | |||||
Tuberculosis | |||||
Hepatitis C | |||||
Influenza A | |||||
HTLV-I infection | |||||
Herpes simplex infection | |||||
NetPath Pathway | TGF_beta_Receptor Signaling Pathway | ||||
TCR Signaling Pathway | |||||
PANTHER Pathway | Apoptosis signaling pathway | ||||
Pathway Interaction Database | Canonical NF-kappaB pathway | ||||
Signaling events mediated by HDAC Class I | |||||
TNF receptor signaling pathway | |||||
Ceramide signaling pathway | |||||
Negative effector of Fas and TNF-alpha | |||||
Caspase Cascade in Apoptosis | |||||
Reactome | TNFR1-induced proapoptotic signaling | ||||
Regulation of TNFR1 signaling | |||||
TNFR1-induced NFkappaB signaling pathway | |||||
TNFR1-mediated ceramide production | |||||
TNFs bind their physiological receptors | |||||
TNF signaling | |||||
WikiPathways | Inflammatory Response Pathway | ||||
Apoptosis Modulation by HSP70 | |||||
Cardiac Hypertrophic Response | |||||
Apoptosis | |||||
Nanoparticle triggered regulated necrosis | |||||
Amyotrophic lateral sclerosis (ALS) | |||||
Integrated Pancreatic Cancer Pathway | |||||
TNF alpha Signaling Pathway | |||||
Alzheimers Disease | |||||
Extrinsic Pathway for Apoptosis | |||||
Apoptosis Modulation and Signaling | |||||
References | |||||
Ref 523888 | ClinicalTrials.gov (NCT01587807) A Study to Investigate the Safety, Tolerability, Pharmacokinetics and Pharmacodynamics of Single Doses of Inhaled GSK1995057. U.S. National Institutes of Health. | ||||
Ref 524174 | ClinicalTrials.gov (NCT01759056) Evaluation of an Oral Anti-TNF Antibody in Patients With Active Ulcerative Colitis. U.S. National Institutes of Health. | ||||
Ref 527270 | Secretion of a TNFR:Fc fusion protein following pulmonary administration of pseudotyped adeno-associated virus vectors. J Virol. 2004 Nov;78(22):12355-65. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.