Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T51407
|
||||
Former ID |
TTDNR00671
|
||||
Target Name |
Exportin-1
|
||||
Gene Name |
XPO1
|
||||
Synonyms |
Chromosome region maintenance 1 protein homolog; Exp1; XPO1
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Cancer [ICD9: 140-229; ICD10: C00-C96] | ||||
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
Function |
Mediates the nuclear export of cellular proteins (cargos) bearing a leucine-rich nuclear export signal (NES) and of RNAs. In the nucleus, in association with RANBP3, binds cooperatively to the NES on its target protein and to the GTPase RAN in its active GTP-bound form (Ran-GTP). Docking of this complex to the nuclear pore complex (NPC) is mediated through binding to nucleoporins. Upon transit of a nuclear export complex into the cytoplasm, disassembling ofthe complex and hydrolysis of Ran-GTP to Ran-GDP (induced by RANBP1 and RANGAP1, respectively) cause release of the cargo from the export receptor. The directionality of nuclear export is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Involved in U3 snoRNA transport from Cajal bodies to nucleoli. Binds to late precursor U3 snoRNA bearing a TMG cap. Several viruses, among them HIV-1, HTLV-1 and influenza A use it to export their unspliced or incompletely spliced RNAs out of the nucleus. Interacts with, and mediates the nuclear export of HIV-1 Rev and HTLV-1 Rex proteins. Involved in HTLV-1 Rex multimerization.
|
||||
BioChemical Class |
Exportin
|
||||
UniProt ID | |||||
Sequence |
MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAW
TRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCV EKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFD FSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGY IFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPL NTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEV EETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPPRRQLYLPMLFKVRLLM VSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKL HNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAII ASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFV QVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLL PNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNV YKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPL LDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEE YPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKHTMRNVADTGLQILFTL LQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKIST SLNPGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLV QIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD |
||||
Drugs and Mode of Action | |||||
Drug(s) | KPT-330 | Drug Info | Phase 2 | Solid tumours | [1] |
KOS-1815 | Drug Info | Preclinical | Cancer | [2] | |
Inhibitor | KOS-1815 | Drug Info | [3] | ||
KPT-330 | Drug Info | [3] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
DRM | DRM Info | ||||
Pathways | |||||
KEGG Pathway | Ribosome biogenesis in eukaryotes | ||||
RNA transport | |||||
Influenza A | |||||
HTLV-I infection | |||||
Epstein-Barr virus infection | |||||
Pathway Interaction Database | Signaling events mediated by HDAC Class II | ||||
Canonical NF-kappaB pathway | |||||
Integrin-linked kinase signaling | |||||
Signaling events mediated by HDAC Class I | |||||
Role of Calcineurin-dependent NFAT signaling in lymphocytes | |||||
FoxO family signaling | |||||
Sumoylation by RanBP2 regulates transcriptional repression | |||||
Hedgehog signaling events mediated by Gli proteins | |||||
Regulation of nuclear beta catenin signaling and target gene transcription | |||||
Reactome | Separation of Sister Chromatids | ||||
Resolution of Sister Chromatid Cohesion | |||||
Deactivation of the beta-catenin transactivating complex | |||||
HuR (ELAVL1) binds and stabilizes mRNA | |||||
RHO GTPases Activate Formins | |||||
Mitotic Prometaphase | |||||
Cyclin A/B1 associated events during G2/M transition | |||||
WikiPathways | Mitotic Metaphase and Anaphase | ||||
Signaling by TGF-beta Receptor Complex | |||||
Regulation of mRNA Stability by Proteins that Bind AU-rich Elements | |||||
Host Interactions of HIV factors | |||||
Influenza Life Cycle | |||||
HIV Life Cycle | |||||
Mitotic Prometaphase | |||||
Mitotic G2-G2/M phases | |||||
References | |||||
REF 1 | ClinicalTrials.gov (NCT02025985) Phase II Study of KPT-330 (Selinexor) in Female Patients With Advanced Gynaecologic Malignancies. U.S. National Institutes of Health. | ||||
REF 2 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800024269) | ||||
REF 3 | Inhibition of CRM1-dependent nuclear export sensitizes malignant cells to cytotoxic and targeted agents. Semin Cancer Biol. 2014 August; 0: 62-73. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.