Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T03644
|
||||
| Former ID |
TTDI02186
|
||||
| Target Name |
Alpha-synuclein
|
||||
| Gene Name |
SNCA
|
||||
| Synonyms |
NACP; NonA beta component of AD amyloid; NonA4 component of amyloid precursor; SNCA
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Alzheimer disease [ICD9: 331; ICD10: G30] | ||||
| Parkinson's disease [ICD9: 332; ICD10: G20] | |||||
| Function |
May be involved in the regulation of dopamine release and transport. Induces fibrillization of microtubule-associated protein tau. Reduces neuronal responsiveness to various apoptotic stimuli, leading to a decreased caspase-3 activation.
|
||||
| BioChemical Class |
Synuclein family
|
||||
| UniProt ID | |||||
| Sequence |
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP DNEAYEMPSEEGYQDYEPEA |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Posiphen R-phenserine | Drug Info | Phase 1 | Alzheimer disease | [1] |
| RG7935 | Drug Info | Phase 1 | Parkinson's disease | [2] | |
| Modulator | Posiphen R-phenserine | Drug Info | [1], [3] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Alzheimer' | ||||
| s disease | |||||
| Parkinson' | |||||
| NetPath Pathway | Leptin Signaling Pathway | ||||
| RANKL Signaling Pathway | |||||
| PANTHER Pathway | Parkinson disease | ||||
| Pathway Interaction Database | Alpha-synuclein signaling | ||||
| Reactome | Amyloid formation | ||||
| WikiPathways | Ectoderm Differentiation | ||||
| Parkinsons Disease Pathway | |||||
| Parkin-Ubiquitin Proteasomal System pathway | |||||
| Alzheimers Disease | |||||
| References | |||||
| REF 1 | The Anticholinesterase Phenserine and Its Enantiomer Posiphen as 5??ntranslated-Region-Directed Translation Blockers of the Parkinson's Alpha Synuclein Expression. Parkinson's Disease Volume 2012 (2012), Article ID 142372, Page(13). | ||||
| REF 2 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800040327) | ||||
| REF 3 | The Anticholinesterase Phenserine and Its Enantiomer Posiphen as 5??ntranslated-Region-Directed Translation Blockers of the Parkinson's Alpha Synuclein Expression. Parkinson's Disease Volume 2012 (2012), Article ID 142372, Page(13). | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.