Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T32060
|
||||
Former ID |
TTDS00103
|
||||
Target Name |
5-hydroxytryptamine 2A receptor
|
||||
Gene Name |
HTR2A
|
||||
Synonyms |
5-HT-2; 5-HT-2A; 5-HT2A receptor; 5-hydroxytryptamine receptor 2A; Serotonin receptor; Serotonin receptor 2A; HTR2A
|
||||
Target Type |
Successful
|
||||
Disease | Alcohol use disorders [ICD9: 303; ICD10: F10.2] | ||||
Anxiety disorder [ICD9: 300, 311; ICD10: F32, F40-F42] | |||||
Addiction [ICD code not available] | |||||
Central nervous system disease [ICD10: G00-G99] | |||||
Cardiovascular disorder [ICD10: I00-I99] | |||||
Cerebrovascular ischaemia [ICD9: 434.91; ICD10: I61-I63] | |||||
Diabetes [ICD9: 253.5, 588.1; ICD10: E23.2, N25.1] | |||||
Depression [ICD9: 311; ICD10: F30-F39] | |||||
Erythropoietic porphyria [ICD10: E80.0] | |||||
Female sexual dysfunction [ICD9: 302.7; ICD10: F52] | |||||
Fibromyalgia [ICD9: 729.1; ICD10: M79.7] | |||||
Glaucoma [ICD9: 365; ICD10: H40-H42] | |||||
Hypertension [ICD9: 401; ICD10: I10-I16] | |||||
Hemorrhoids [ICD10: I84] | |||||
Major depressive disorder [ICD9: 296.2, 296.3, 710.0; ICD10: F32, F33, M32] | |||||
Migraine [ICD9: 346; ICD10: G43] | |||||
Mood disorder [ICD10: F30-F39] | |||||
Pancreatitis [ICD9: 577.0-577.1; ICD10: K85, K86.0K86.1] | |||||
Parkinson's disease; Psychosis; Schizophrenia [ICD9:290-299, 332, 295; ICD10: F02.3, F20-F29, G20, F20] | |||||
Parkinson disease psychosis [ICD10: G00-G99] | |||||
Psychotic disorders [ICD9: 290-299; ICD10: F20-F29] | |||||
Psychiatric disorder [ICD9: 290-319; ICD10: F01-F99] | |||||
Schizophrenia; Sleep maintenance insomnia [ICD9:295, 307.41, 307.42, 327.0, 780.51, 780.52; ICD10: F20, F51.0, G47.0] | |||||
Schizophrenia; Schizoaffective disorders [ICD9: 295, 295.70; ICD10: F20, F25] | |||||
Sleep initiation and maintenance disorders; Primary insomnia; Schizophrenia [ICD9: 295, 307.41, 307.42, 327.0, 780.51, 780.52; ICD10: F20, F51.0, G47.0] | |||||
Severe mood disorders [ICD9: 296; ICD10: F30-F39] | |||||
Schizophrenia [ICD9: 295; ICD10: F20] | |||||
Sleep disorders [ICD9: 307.4, 327, 780.5; ICD10: F51, G47] | |||||
Unspecified [ICD code not available] | |||||
Function |
G-protein coupled receptor for5-hydroxytryptamine (serotonin). Also functions as a receptor for various drugs and psychoactive substances, including mescaline, psilocybin, 1-(2,5- dimethoxy-4-iodophenyl)-2-aminopropane (DOI) and lysergic acid diethylamide (LSD). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling activates phospholipase C and a phosphatidylinositol-calcium second messenger system that modulates the activity of phosphatidylinositol 3-kinase and promotes the release of Ca(2+) ions from intracellular stores. Affects neural activity, perception, cognition and mood. Plays a role in the regulation of behavior, including responses to anxiogenic situations and psychoactive substances. Plays a role in intestinal smooth muscle contraction, and may play a role in arterial vasoconstriction.
|
||||
BioChemical Class |
GPCR rhodopsin
|
||||
Target Validation |
T32060
|
||||
UniProt ID | |||||
Sequence |
MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV |
||||
Drugs and Mode of Action | |||||
Drug(s) | Abilify Maintena | Drug Info | Approved | Erythropoietic porphyria | [551871] |
Aniracetam | Drug Info | Approved | Cerebrovascular ischaemia | [467478], [526084] | |
Flibanserin | Drug Info | Approved | Mood disorder | [532651], [542987] | |
Iloperidone | Drug Info | Approved | Schizophrenia | [530677], [543255] | |
Lurasidone hydrochloride | Drug Info | Approved | Schizophrenia | [530859], [531351], [542486], [551871] | |
Pimavanserin | Drug Info | Approved | Parkinson disease psychosis | [889440] | |
Sarpogrelate | Drug Info | Approved | Diabetes | [535855], [539330] | |
ZOTEPINE | Drug Info | Approved | Anxiety disorder | [538628], [551871] | |
Blonanserin | Drug Info | Phase 3 | Schizophrenia | [536463], [542649] | |
Flibanserin | Drug Info | Phase 3 | Female sexual dysfunction | [536493], [542987] | |
ITI-007 | Drug Info | Phase 3 | Schizophrenia; Sleep maintenance insomnia | [525226], [549912] | |
Low dose ITI-007 | Drug Info | Phase 3 | Schizophrenia | [548546] | |
M100907 | Drug Info | Phase 3 | Sleep disorders | [522054] | |
Pimavanserin | Drug Info | Phase 3 | Parkinson's disease; Psychosis; Schizophrenia | [543125], [547301] | |
SR46349B | Drug Info | Phase 3 | Sleep initiation and maintenance disorders; Primary insomnia; Schizophrenia | [536463] | |
TNX-102 | Drug Info | Phase 3 | Fibromyalgia | [547624] | |
TRYPTAMINE | Drug Info | Phase 3 | Discovery agent | [521730], [538764] | |
VOLINANSERIN | Drug Info | Phase 3 | Discovery agent | [522480], [539159] | |
Zicronapine | Drug Info | Phase 3 | Schizophrenia | [523357] | |
BVT.28949 | Drug Info | Phase 2 | Glaucoma | [548204] | |
Ocaperidone | Drug Info | Phase 2 | Schizophrenia; Schizoaffective disorders | [467839], [526792], [536463] | |
PRUVANSERIN | Drug Info | Phase 2 | Sleep disorders | [521764] | |
1192U90 | Drug Info | Phase 1 | Psychotic disorders | [534252] | |
Abaperidone | Drug Info | Phase 1 | Schizophrenia | [551815] | |
MIN-101 | Drug Info | Phase 1 | Schizophrenia | [524902] | |
SKL-10406 | Drug Info | Phase 1 | Major depressive disorder | [549136] | |
Temanogrel | Drug Info | Phase 1 | Cardiovascular disorder | [524599] | |
YKP-1358 | Drug Info | Phase 1 | Schizophrenia; Schizoaffective disorders | [536463] | |
Org-23366 | Drug Info | Preclinical | Schizophrenia | [536463] | |
LYSERGIC ACID DIETHYLAMIDE | Drug Info | Withdrawn from market | Addiction | [526769], [539053] | |
Deramciclane | Drug Info | Discontinued in Phase 3 | Anxiety disorder | [540889], [544913] | |
Iferanserin-Ventrus | Drug Info | Discontinued in Phase 3 | Hemorrhoids | [547235] | |
MDL-11939 | Drug Info | Discontinued in Phase 3 | Anxiety disorder | [539169], [544618] | |
Ritanserin | Drug Info | Discontinued in Phase 3 | Anxiety disorder | [543335], [544590] | |
TIOSPIRONE | Drug Info | Discontinued in Phase 3 | Discovery agent | [538617], [544679] | |
Adatanserin | Drug Info | Discontinued in Phase 2 | Severe mood disorders | [536580] | |
AMESERGIDE | Drug Info | Discontinued in Phase 2 | Mood disorder | [539285], [544787] | |
ATI-9242 | Drug Info | Discontinued in Phase 2 | Schizophrenia | [548733] | |
FCE-22716 | Drug Info | Discontinued in Phase 2 | Hypertension | [533340] | |
MAZAPERTINE | Drug Info | Discontinued in Phase 2 | Discovery agent | [545274] | |
NELOTANSERIN | Drug Info | Discontinued in Phase 2 | Sleep disorders | [548083] | |
SERAZAPINE HYDROCHLORIDE | Drug Info | Discontinued in Phase 2 | Anxiety disorder | [544867] | |
SERGOLEXOLE MALEATE | Drug Info | Discontinued in Phase 2 | Migraine | [544716] | |
SL65.0472 | Drug Info | Discontinued in Phase 2 | Cardiovascular disorder | [547242] | |
YM-992 | Drug Info | Discontinued in Phase 2 | Depression | [546447] | |
AM-831 | Drug Info | Discontinued in Phase 1 | Schizophrenia | [547459] | |
DUP-734 | Drug Info | Discontinued in Phase 1 | Psychotic disorders | [544981] | |
1192U90 | Drug Info | Terminated | Schizophrenia | [536463] | |
A-80426 | Drug Info | Terminated | Discovery agent | [546043] | |
AMPEROZIDE | Drug Info | Terminated | Alcohol use disorders | [544701] | |
DV-7028 | Drug Info | Terminated | Cardiovascular disorder | [545055] | |
Fananserin | Drug Info | Terminated | Schizophrenia | [536463], [540837] | |
GMC-283 | Drug Info | Terminated | Schizophrenia | [536463] | |
ICI-169369 | Drug Info | Terminated | Anxiety disorder | [539780], [544709] | |
LY53857 | Drug Info | Terminated | Discovery agent | [539138], [544876] | |
MDL-28161 | Drug Info | Terminated | Discovery agent | [544961] | |
R-102444 | Drug Info | Terminated | Pancreatitis | [547365] | |
Ro-60-0175 | Drug Info | Terminated | Discovery agent | [539026], [546467] | |
RP-68303 | Drug Info | Terminated | Discovery agent | [545423] | |
ZD-3638 | Drug Info | Terminated | Schizophrenia | [536463] | |
Agonist | (+)-LSD | Drug Info | [527178] | ||
3,4-Methylenedioxymethamphetamine | Drug Info | [551382] | |||
5-CT | Drug Info | [527178] | |||
Abilify Maintena | Drug Info | [526792], [527134] | |||
ACP-106 | Drug Info | [526792] | |||
AL-37350A | Drug Info | [526713] | |||
alpha-methyl-5-HT | Drug Info | [525890] | |||
AM-831 | Drug Info | [550322] | |||
BRL-15572 | Drug Info | [534475] | |||
BW723C86 | Drug Info | [527178] | |||
DV-7028 | Drug Info | [537955], [538116], [538117] | |||
LP-12 | Drug Info | [528956] | |||
LP-44 | Drug Info | [528956] | |||
m-chlorophenylpiperazine | Drug Info | [534830] | |||
MMDA | Drug Info | [551393] | |||
N-1-isopropyl-5-MeOT | Drug Info | [533905] | |||
N-1-isopropyltryptamine | Drug Info | [533905] | |||
Org 12962 | Drug Info | [527178] | |||
SB 216641 | Drug Info | [534475] | |||
Temanogrel | Drug Info | [526792], [550267] | |||
TFMPP | Drug Info | [527178] | |||
[125I]DOI | Drug Info | [525927] | |||
Inhibitor | (+/-)-nantenine | Drug Info | [530558] | ||
(1-Phenethyl-piperidin-4-yl)-phenyl-methanone | Drug Info | [525963] | |||
(2-Indol-1-yl-ethyl)-dimethyl-amine | Drug Info | [526235] | |||
(2S)-1-(1H-furo[2,3-g]indazol-1-yl)propan-2-amine | Drug Info | [529168] | |||
(2S)-1-(5-fluoro-1H-indazol-1-yl)propan-2-amine | Drug Info | [529168] | |||
(2S)-1-(6-fluoro-1H-indazol-1-yl)propan-2-amine | Drug Info | [529168] | |||
(2S)-1-(6-methoxy-1H-indazol-1-yl)propan-2-amine | Drug Info | [527952] | |||
(E)-2-(4-fluorostyryl)-5-(phenylsulfinyl)pyridine | Drug Info | [528690] | |||
(E)-2-(4-fluorostyryl)-5-(phenylsulfonyl)pyridine | Drug Info | [528690] | |||
(R)-(+)-(4,5,6-trimethoxyindan-1-yl)methanamine | Drug Info | [528294] | |||
(R)-(-)-11-hydroxy-N-n-propylnoraporphine | Drug Info | [529686] | |||
(R)-1-(4-iodo-2,5-dimethoxyphenyl)propan-2-amine | Drug Info | [528778] | |||
(R)-3-(4-propylmorpholin-2-yl)phenol | Drug Info | [529128] | |||
(R,S)-1-(5-bromo-1H-indol-1-yl)propan-2-amine | Drug Info | [551219] | |||
(R,S)-1-(5-chloro-1H-indol-1-yl)propan-2-amine | Drug Info | [551219] | |||
(R,S)-1-(5-fluoro-1H-indol-1-yl)propan-2-amine | Drug Info | [551219] | |||
(R,S)-1-(5-methyl-1H-indol-1-yl)propan-2-amine | Drug Info | [551219] | |||
(R,S)-1-(6-fluoro-1H-indol-1-yl)propan-2-amine | Drug Info | [551219] | |||
(S)-(-)-(4,5,6-trimethoxyindan-1-yl)methanamine | Drug Info | [528294] | |||
(S)-1-(5,6-difluoro-1H-indol-1-yl)propan-2-amine | Drug Info | [551219] | |||
1,2,3,4-Tetrahydro-naphthalen-2-ylamine | Drug Info | [533482] | |||
1,2,3,4-Tetrahydro-pyrazino[1,2-a]indole | Drug Info | [526235] | |||
1,6-bis(4-(3-chlorophenyl)piperazin-1-yl)hexane | Drug Info | [530927] | |||
1,6-bis(4-(3-methoxyphenyl)piperazin-1-yl)hexane | Drug Info | [530927] | |||
1,6-bis(4-(pyridin-2-yl)piperazin-1-yl)hexane | Drug Info | [530927] | |||
1,6-bis(4-m-tolylpiperazin-1-yl)hexane | Drug Info | [530927] | |||
1,6-bis(4-phenylpiperazin-1-yl)hexane | Drug Info | [530927] | |||
1-((R)-2-aminopropyl)-1H-indazol-6-ol | Drug Info | [527952] | |||
1-((S)-2-aminopropyl)-1H-indazol-6-ol | Drug Info | [527952] | |||
1-((S)-2-aminopropyl)-7-chloro-1H-indazol-6-ol | Drug Info | [527952] | |||
1-((S)-2-aminopropyl)-7-fluoro-1H-indazol-6-ol | Drug Info | [527952] | |||
1-((S)-2-aminopropyl)-7-iodo-1H-indazol-6-ol | Drug Info | [527952] | |||
1-((S)-2-aminopropyl)-7-methyl-1H-indazol-6-ol | Drug Info | [527952] | |||
1-(10-Bromoanthracen-9-yl)-2-aminopropane | Drug Info | [529336] | |||
1-(2,5-Dimethoxy-4-methyl-phenyl)-piperazine | Drug Info | [533476] | |||
1-(2,5-Dimethoxy-phenyl)-piperazine | Drug Info | [533476] | |||
1-(2,5-dimethoxyphenyl)propan-2-amine | Drug Info | [529336] | |||
1-(2,6-dimethoxy-4-methylphenyl)propan-2-amine | Drug Info | [529336] | |||
1-(2-aminoethyl)-1H-indazol-6-ol | Drug Info | [527952] | |||
1-(2-Methoxy-phenyl)-4-propyl-piperazine | Drug Info | [533873] | |||
1-(2-Methoxy-phenyl)-piperazine | Drug Info | [533476] | |||
1-(3-(pentafluorosulfanyl)phenyl)propan-2-amine | Drug Info | [529013] | |||
1-(3-(phenylthio)propyl)-4-m-tolylpiperazine | Drug Info | [528625] | |||
1-(3-Trifluoromethyl-phenyl)-piperazine | Drug Info | [533476] | |||
1-(4-Bromo-2,5-difluorophenyl)-2-aminopropane | Drug Info | [529336] | |||
1-(4-Bromo-2,5-dimethoxy-phenyl)-piperazine | Drug Info | [533476] | |||
1-(4-ethyl-2,5-dimethoxyphenyl)propan-2-amine | Drug Info | [529336] | |||
1-Butyl-3-(2-dimethylamino-ethyl)-1H-indol-4-ol | Drug Info | [527668] | |||
1-Butyl-4-(2-methoxy-phenyl)-piperazine | Drug Info | [533873] | |||
1-Ethyl-4-(2-methoxy-phenyl)-piperazine | Drug Info | [533873] | |||
1-methoxy-9-aminomethyl-9,10-dihydroanthracene | Drug Info | [529672] | |||
1-Methyl-1,3-dihydro-indol-2-one | Drug Info | [526055] | |||
1-Naphthalen-1-yl-piperazine | Drug Info | [533482] | |||
1-Naphthalen-2-yl-piperazine | Drug Info | [533482] | |||
1-Propyl-3-(3-trifluoromethyl-phenyl)-pyrrolidine | Drug Info | [551334] | |||
11-Butyryloxy-N-n-propylnoraporphine | Drug Info | [529686] | |||
11-Heptanoyloxy-N-n-propylnoraporphine | Drug Info | [529686] | |||
11-Hexanoyloxy-N-n-propylnoraporphine | Drug Info | [529686] | |||
11-Propionyloxy-N-n-propylnoraporphine | Drug Info | [529686] | |||
11-valeryloxynoraporphine | Drug Info | [529686] | |||
2,2-Diphenyl-ethylamine | Drug Info | [525993] | |||
2,5-dimethoxy-4-bromophenethylamine | Drug Info | [528433] | |||
2-(1H-indol-3-yl)-N,N-dimethylethanamine | Drug Info | [529336] | |||
2-(2-Amino-propyl)-5-bromo-4-methoxy-phenol | Drug Info | [533498] | |||
2-(2-Methoxy-phenyl)-1-methyl-ethylamine | Drug Info | [533498] | |||
2-(3,5-dimethoxy-4-phenethoxyphenyl)ethanamine | Drug Info | [529336] | |||
2-(3-Methoxy-phenyl)-1-methyl-ethylamine | Drug Info | [533498] | |||
2-(4-Bromo-2-methoxy-phenyl)-1-methyl-ethylamine | Drug Info | [533498] | |||
2-(4-Bromo-phenyl)-1-methyl-ethylamine | Drug Info | [533498] | |||
2-(4-Methyl-piperazin-1-yl)-4-phenyl-pyrimidine | Drug Info | [551319] | |||
2-(5-Methoxy-1H-indol-3-yl)-1-methyl-ethylamine | Drug Info | [527952] | |||
2-(9,10-dihydroanthracen-9-yl)-N-methylethanamine | Drug Info | [530331] | |||
2-(piperazin-1-yl)-5,6,7,8-tetrahydroquinoline | Drug Info | [530516] | |||
2-methoxy-9-aminomethyl-9,10-dihydroanthracene | Drug Info | [529672] | |||
2-Phenyl-3-(2-piperidin-1-yl-ethyl)-1H-indole | Drug Info | [525940] | |||
2-Phenyl-3-piperidin-4-yl-1H-indole | Drug Info | [525940] | |||
2-Piperazin-1-yl-phenol | Drug Info | [533476] | |||
3-(1-Benzyl-piperidin-4-yl)-2-phenyl-1H-indole | Drug Info | [525940] | |||
3-(1-Methyl-piperidin-4-yl)-2-phenyl-1H-indole | Drug Info | [525940] | |||
3-(1-Phenethyl-piperidin-4-yl)-2-phenyl-1H-indole | Drug Info | [525940] | |||
3-(2-Amino-propyl)-1H-indol-5-ol | Drug Info | [527952] | |||
3-(2-Dimethylamino-ethyl)-1-methyl-1H-indol-4-ol | Drug Info | [527668] | |||
3-(2-Dimethylamino-ethyl)-1H-indol-6-ol | Drug Info | [527668] | |||
3-(2-Dimethylamino-ethyl)-2-methyl-1H-indol-4-ol | Drug Info | [527668] | |||
3-(2-Dimethylamino-propyl)-1H-indol-4-ol | Drug Info | [527668] | |||
3-(2-Pyrrolidin-1-yl-ethyl)-1H-indol-4-ol | Drug Info | [527668] | |||
3-(3-Dimethylamino-propyl)-1H-indol-4-ol | Drug Info | [527668] | |||
3-Amino-1-(2-amino-5-methoxy-phenyl)-propan-1-one | Drug Info | [533476] | |||
3-Dimethylaminomethyl-1-methyl-1H-indol-4-ol | Drug Info | [527668] | |||
3-Dimethylaminomethyl-1H-indol-4-ol | Drug Info | [527668] | |||
3-methoxy-9-aminomethyl-9,10-dihydroanthracene | Drug Info | [529672] | |||
3-Naphthalen-1-yl-1-propyl-pyrrolidine | Drug Info | [551334] | |||
3-Naphthalen-1-yl-pyrrolidine | Drug Info | [551334] | |||
4,4-Diphenylbutan-1-amine | Drug Info | [530331] | |||
4-(10H-Anthracen-9-ylidene)-1-methyl-piperidine | Drug Info | [525993] | |||
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [531079] | |||
4-(4-Fluoro-benzyl)-piperidine hydrochloride | Drug Info | [526959] | |||
4-Benzyl-1-methyl-piperidine hydrochloride | Drug Info | [526959] | |||
4-methoxy-9-aminomethyl-9,10-dihydroanthracene | Drug Info | [529672] | |||
5,6-dichloro-3,4-dihydroquinazolin-2-amine | Drug Info | [529148] | |||
5-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [526899] | |||
5-chloro-3,4-dihydroquinazolin-2-amine | Drug Info | [529148] | |||
5-chloro-N-(pyridin-3-yl)indoline-1-carboxamide | Drug Info | [551219] | |||
5-MEO-DMT | Drug Info | [527952] | |||
5-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [526899] | |||
5-Methoxy-4,9-dihydro-3H-beta-carboline | Drug Info | [526899] | |||
5-METHOXYTRYPTAMINE | Drug Info | [533464] | |||
6,7-dichloro-2,3,4,5-tetrahydro-1H-3-benzazepine | Drug Info | [529221] | |||
6-bromoaplysinopsin | Drug Info | [526321] | |||
6-Chloro-1,2,3,4-tetrahydro-pyrazino[1,2-a]indole | Drug Info | [526235] | |||
6-chloro-N-(pyridin-3-yl)indoline-1-carboxamide | Drug Info | [551219] | |||
6-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [526899] | |||
7,8,9,10-tetrahydro-6H-furo-[2,3-g][3]benzazepine | Drug Info | [529221] | |||
7,8,9,10-tetrahydro-6H-furo-[3,2-g][3]benzazepine | Drug Info | [529221] | |||
7-Chloro-1,2,3,4-tetrahydro-pyrazino[1,2-a]indole | Drug Info | [526235] | |||
7-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [526899] | |||
8-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [526899] | |||
8-Bromo-4,9-dihydro-3H-beta-carboline | Drug Info | [526899] | |||
8-Chloro-1,2,3,4-tetrahydro-pyrazino[1,2-a]indole | Drug Info | [526235] | |||
8-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [526899] | |||
8-Methoxy-2-(4-methyl-piperazin-1-yl)-quinoline | Drug Info | [533482] | |||
8-Methoxy-2-piperazin-1-yl-quinoline | Drug Info | [533482] | |||
8-Methoxy-4,9-dihydro-3H-beta-carboline | Drug Info | [526899] | |||
9-(2-aminoethyl)-9,10-dihydroanthracene | Drug Info | [530331] | |||
9-(2-aminopropyl)-9,10-dihydroanthracene | Drug Info | [530331] | |||
9-(Aminomethyl)-9,10-dihydroanthracene | Drug Info | [525993] | |||
9-(N-benzylaminomethyl)-9,10-dihydroanthracene | Drug Info | [530613] | |||
A-80426 | Drug Info | [527799] | |||
A-987306 | Drug Info | [529789] | |||
ALTANSERIN | Drug Info | [530045] | |||
Aniracetam | Drug Info | [551390] | |||
APLYSINOPSIN | Drug Info | [551219] | |||
BARETTIN | Drug Info | [528498] | |||
Brolamfetamine | Drug Info | [529463] | |||
C-(5-bromo-4,7-dimethoxyindan-1-yl)methylamine | Drug Info | [528433] | |||
C-(5H-Dibenzo[a,d]cyclohepten-5-yl)-methylamine | Drug Info | [525993] | |||
C-(9H-Thioxanthen-9-yl)-methylamine | Drug Info | [525993] | |||
C-(9H-Xanthen-9-yl)-methylamine | Drug Info | [525993] | |||
CHLOROPHENYLPIPERAZINE | Drug Info | [530589] | |||
CINANSERIN | Drug Info | [533464] | |||
Dimethyltryptamine | Drug Info | [551401] | |||
DOM | Drug Info | [529336] | |||
Etisulergine | Drug Info | [533501] | |||
FLUANISONE | Drug Info | [533378] | |||
ISOCLOZAPINE | Drug Info | [534532] | |||
LY433222 | Drug Info | [536286] | |||
LYSERGIC ACID DIETHYLAMIDE | Drug Info | [528294] | |||
MAZAPERTINE | Drug Info | [533800] | |||
MDL-11939 | Drug Info | [526959] | |||
MDL-28161 | Drug Info | [526959] | |||
MESCALINE | Drug Info | [529336] | |||
N,N-dimethyl-2,2-diphenylethanamine | Drug Info | [530331] | |||
N,N-Dimethyl-3,3-diphenylpropan-1-amine | Drug Info | [530331] | |||
N,N-dimethyl-4,4-diphenylbutan-1-amine | Drug Info | [530331] | |||
N-(1-(1-phenylethyl)piperidin-4-yl)-1-naphthamide | Drug Info | [528639] | |||
N-(1-(1-phenylethyl)piperidin-4-yl)-2-naphthamide | Drug Info | [528639] | |||
N-(1-(3-bromobenzyl)piperidin-4-yl)-1-naphthamide | Drug Info | [528638] | |||
N-(1-(3-bromobenzyl)piperidin-4-yl)-2-naphthamide | Drug Info | [528638] | |||
N-(1-(4-bromobenzyl)piperidin-4-yl)-2-naphthamide | Drug Info | [528638] | |||
N-(1-(4-nitrobenzyl)piperidin-4-yl)-2-naphthamide | Drug Info | [528638] | |||
N-(1-(4-phenylbutyl)piperidin-4-yl)-1-naphthamide | Drug Info | [528639] | |||
N-(1-(4-phenylbutyl)piperidin-4-yl)-2-naphthamide | Drug Info | [528639] | |||
N-(1-benzylpiperidine-4-yl)-2-naphthamide | Drug Info | [528638] | |||
N-(1-phenethylpiperidin-4-yl)-1-naphthamide | Drug Info | [528639] | |||
N-(1-phenethylpiperidin-4-yl)-2-naphthamide | Drug Info | [528639] | |||
N-3'-ethylaplysinopsin | Drug Info | [526321] | |||
N-methyl-3,3-diphenylpropan-1-amine | Drug Info | [530331] | |||
N-methyl-4,4-diphenylbutan-1-amine | Drug Info | [530331] | |||
PG-01037 | Drug Info | [528974] | |||
PHENETHYLAMINE | Drug Info | [525993] | |||
PHENYLPIPERAZINE | Drug Info | [533482] | |||
PSILOCIN | Drug Info | [529336] | |||
QUIPAZINE | Drug Info | [530451] | |||
Racemic DOI | Drug Info | [529336] | |||
Racemic DOTFM | Drug Info | [529336] | |||
Ro-60-0175 | Drug Info | [529168] | |||
RP-68303 | Drug Info | [534052] | |||
SB-271046 | Drug Info | [529191] | |||
SEROTONIN | Drug Info | [530451] | |||
SPIPERONE | Drug Info | [534417] | |||
TIOSPIRONE | Drug Info | [534093] | |||
TRYPTAMINE | Drug Info | [533464] | |||
TRYPTOLINE | Drug Info | [526899] | |||
VER-2692 | Drug Info | [527833] | |||
VER-3323 | Drug Info | [527037] | |||
VER-5384 | Drug Info | [527037] | |||
VER-5593 | Drug Info | [527037] | |||
VOLINANSERIN | Drug Info | [530045] | |||
WAY-208466 | Drug Info | [530209] | |||
YM-348 | Drug Info | [529221] | |||
YM-992 | Drug Info | [536286] | |||
ZOTEPINE | Drug Info | [525963] | |||
[2-(4-Fluoro-1H-indol-3-yl)-ethyl]-dimethyl-amine | Drug Info | [527668] | |||
[2-(6-Methoxy-indol-1-yl)-ethyl]-dimethyl-amine | Drug Info | [526235] | |||
Antagonist | 1192U90 | Drug Info | [536463] | ||
9-OH-risperidone | Drug Info | [534281] | |||
Adatanserin | Drug Info | [534942], [536580] | |||
AMESERGIDE | Drug Info | [526792], [533907] | |||
Blonanserin | Drug Info | [536463] | |||
bufotenine | Drug Info | [534136] | |||
BVT.28949 | Drug Info | [526792], [544175] | |||
cyamemazine | Drug Info | [526510] | |||
EGIS-7625 | Drug Info | [527053] | |||
Fananserin | Drug Info | [536463] | |||
FCE-22716 | Drug Info | [526792], [533340] | |||
GMC-283 | Drug Info | [536463] | |||
Iloperidone | Drug Info | [530677], [536463] | |||
ITI-007 | Drug Info | [551041] | |||
Low dose ITI-007 | Drug Info | [526792], [551041] | |||
LY063518 | Drug Info | [534232] | |||
LY108742 | Drug Info | [533905] | |||
LY215840 | Drug Info | [533905] | |||
LY314228 | Drug Info | [534232] | |||
LY320954 | Drug Info | [534232] | |||
LY53857 | Drug Info | [535896], [535927], [536352], [538142] | |||
LY86057 | Drug Info | [533905] | |||
M100907 | Drug Info | [535134] | |||
metergoline | Drug Info | [527178] | |||
MIN-101 | Drug Info | [526792] | |||
MPDT | Drug Info | [525722] | |||
norfluoxetine | Drug Info | [525929] | |||
Org-23366 | Drug Info | [536463] | |||
Ritanserin | Drug Info | [536752], [536787], [538142] | |||
Sarpogrelate | Drug Info | [537172], [537535], [538037] | |||
SB 215505 | Drug Info | [525458] | |||
SB 221284 | Drug Info | [527178] | |||
SB 228357 | Drug Info | [525730] | |||
SB 242084 | Drug Info | [534428] | |||
SERAZAPINE HYDROCHLORIDE | Drug Info | [526792], [533896] | |||
SERGOLEXOLE MALEATE | Drug Info | [526792], [533252] | |||
spiramide | Drug Info | [527178] | |||
TNX-102 | Drug Info | [551739] | |||
[11C]volinanserin | Drug Info | [525893] | |||
[18F]altanserin | Drug Info | [534323] | |||
[3H]fananserin | Drug Info | [534046] | |||
[3H]N-methylspiperone | Drug Info | [525890] | |||
Modulator | Abaperidone | Drug Info | [553290] | ||
AMPEROZIDE | Drug Info | ||||
ATI-9242 | Drug Info | [526792], [550651] | |||
Deramciclane | Drug Info | [534609] | |||
DUP-734 | Drug Info | ||||
EPLIVANSERIN MESILATE | Drug Info | ||||
Flibanserin | Drug Info | [532651] | |||
ICI-169369 | Drug Info | ||||
Iferanserin-Ventrus | Drug Info | [543891] | |||
Lurasidone hydrochloride | Drug Info | [530859], [531351] | |||
NELOTANSERIN | Drug Info | ||||
Ocaperidone | Drug Info | [526792] | |||
Pimavanserin | Drug Info | ||||
PRUVANSERIN | Drug Info | [552847] | |||
R-102444 | Drug Info | [535964] | |||
SEL-73 | Drug Info | [526792] | |||
SL65.0472 | Drug Info | ||||
SR46349B | Drug Info | ||||
Very low dose (VLD) cyclobenzaprine | Drug Info | [526792] | |||
YKP-1358 | Drug Info | [528644] | |||
Zicronapine | Drug Info | [549861] | |||
Binder | SKL-10406 | Drug Info | [544111] | ||
ZD-3638 | Drug Info | [536463] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Calcium signaling pathway | ||||
Neuroactive ligand-receptor interaction | |||||
Gap junction | |||||
Serotonergic synapse | |||||
Inflammatory mediator regulation of TRP channels | |||||
PANTHER Pathway | 5HT2 type receptor mediated signaling pathway | ||||
Reactome | Serotonin receptors | ||||
G alpha (q) signalling events | |||||
WikiPathways | Serotonin Receptor 2 and STAT3 Signaling | ||||
Serotonin Receptor 2 and ELK-SRF/GATA4 signaling | |||||
SIDS Susceptibility Pathways | |||||
Monoamine GPCRs | |||||
GPCRs, Class A Rhodopsin-like | |||||
Gastrin-CREB signalling pathway via PKC and MAPK | |||||
GPCR ligand binding | |||||
GPCR downstream signaling | |||||
GPCRs, Other | |||||
References | |||||
Ref 467478 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4133). | ||||
Ref 467839 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 46). | ||||
Ref 521730 | ClinicalTrials.gov (NCT00227136) Effect of Oral 5-HTP Intake on Urinary 5-HIAA Excretion. U.S. National Institutes of Health. | ||||
Ref 521764 | ClinicalTrials.gov (NCT00259311) Efficacy Study of LY2422347 to Treat Insomnia. U.S. National Institutes of Health. | ||||
Ref 522054 | ClinicalTrials.gov (NCT00495885) Efficacy and Safety of M100907 on Sleep Maintenance Insomnia With a Sub-study in Stable Type II Diabetes Mellitus. U.S. National Institutes of Health. | ||||
Ref 522480 | ClinicalTrials.gov (NCT00788515) Comparison of Volinanserin and Lormetazepam in the Treatment of Insomnia Characterized by Sleep Maintenance Difficulties. U.S. National Institutes of Health. | ||||
Ref 523357 | ClinicalTrials.gov (NCT01295372) Safety and Efficacy of Zicronapine in Patients With Schizophrenia. U.S. National Institutes of Health. | ||||
Ref 524599 | ClinicalTrials.gov (NCT02034292) Safety Study of APD-791 With Aspirin and/or Clopidogrel. U.S. National Institutes of Health. | ||||
Ref 524902 | ClinicalTrials.gov (NCT02232529) Pharmacokinetic Study of MIN-101 in Healthy Subjects. U.S. National Institutes of Health. | ||||
Ref 525226 | ClinicalTrials.gov (NCT02469155) A Trial to Assess the Antipsychotic Efficacy of ITI-007 Over 6 Weeks of Treatment. | ||||
Ref 526084 | Anxiolytic effects of aniracetam in three different mouse models of anxiety and the underlying mechanism. Eur J Pharmacol. 2001 May 18;420(1):33-43. | ||||
Ref 526769 | Psychopathology and psychophysiology of minimal LSD-25 dosage; a preliminary dosage-response spectrum. AMA Arch Neurol Psychiatry. 1958 Feb;79(2):208-10. | ||||
Ref 526792 | Pharmacological profile of the new potent neuroleptic ocaperidone (R 79,598). J Pharmacol Exp Ther. 1992 Jan;260(1):146-59. | ||||
Ref 530859 | Pharmacological profile of lurasidone, a novel antipsychotic agent with potent 5-hydroxytryptamine 7 (5-HT7) and 5-HT1A receptor activity. J Pharmacol Exp Ther. 2010 Jul;334(1):171-81. | ||||
Ref 533340 | Mechanism of the antihypertensive effect of FCE 22716, a new ergoline derivative, in the spontaneously hypertensive rat. Pharmacology. 1989;38(2):78-92. | ||||
Ref 534252 | 1192U90 in animal tests that predict antipsychotic efficacy, anxiolysis, and extrapyramidal side effects. Neuropsychopharmacology. 1996 Sep;15(3):231-42. | ||||
Ref 535855 | A 50-year history of new drugs in Japan-the development and trends of hemostatics and antithrombotic drugs. Yakushigaku Zasshi. 2003;38(1):93-105. | ||||
Ref 536463 | The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. Epub 2007 Jul 31. | ||||
Ref 536493 | Designing drugs for the treatment of female sexual dysfunction. Drug Discov Today. 2007 Sep;12(17-18):757-66. Epub 2007 Aug 27. | ||||
Ref 536580 | Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. Epub 2008 Jan 2. | ||||
Ref 538617 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 101). | ||||
Ref 538628 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 103). | ||||
Ref 538764 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 125). | ||||
Ref 539026 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 166). | ||||
Ref 539053 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 17). | ||||
Ref 539138 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 183). | ||||
Ref 539159 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 185). | ||||
Ref 539169 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 186). | ||||
Ref 539285 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 199). | ||||
Ref 539330 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 210). | ||||
Ref 539780 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 273). | ||||
Ref 540837 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5434). | ||||
Ref 540889 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5490). | ||||
Ref 542486 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7461). | ||||
Ref 542649 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7670). | ||||
Ref 542987 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8182). | ||||
Ref 543125 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8423). | ||||
Ref 543255 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 87). | ||||
Ref 543335 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 97). | ||||
Ref 544590 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000237) | ||||
Ref 544618 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000314) | ||||
Ref 544679 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000562) | ||||
Ref 544701 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000669) | ||||
Ref 544709 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000690) | ||||
Ref 544716 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000706) | ||||
Ref 544787 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001117) | ||||
Ref 544867 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001373) | ||||
Ref 544876 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001395) | ||||
Ref 544913 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001479) | ||||
Ref 544961 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001723) | ||||
Ref 544981 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001777) | ||||
Ref 545055 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001984) | ||||
Ref 545274 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002662) | ||||
Ref 545423 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003204) | ||||
Ref 546043 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006017) | ||||
Ref 546447 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008166) | ||||
Ref 546467 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008324) | ||||
Ref 547235 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014343) | ||||
Ref 547242 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014358) | ||||
Ref 547301 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014997) | ||||
Ref 547365 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015510) | ||||
Ref 547459 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016551) | ||||
Ref 547624 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017946) | ||||
Ref 548083 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021795) | ||||
Ref 548204 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023041) | ||||
Ref 548546 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026498) | ||||
Ref 548733 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028165) | ||||
Ref 549136 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032727) | ||||
Ref 525458 | Attenuation of haloperidol-induced catalepsy by a 5-HT2C receptor antagonist. Br J Pharmacol. 1999 Feb;126(3):572-4. | ||||
Ref 525722 | 2-Substituted tryptamines: agents with selectivity for 5-HT(6) serotonin receptors. J Med Chem. 2000 Mar 9;43(5):1011-8. | ||||
Ref 525730 | Biarylcarbamoylindolines are novel and selective 5-HT(2C) receptor inverse agonists: identification of 5-methyl-1-[[2-[(2-methyl-3-pyridyl)oxy]- 5-pyridyl]carbamoyl]-6-trifluoromethylindoline (SB-243213) as a potential antidepressant/anxiolytic agent. J Med Chem. 2000 Mar 23;43(6):1123-34. | ||||
Ref 525890 | Differential modes of agonist binding to 5-hydroxytryptamine(2A) serotonin receptors revealed by mutation and molecular modeling of conserved residues in transmembrane region 5. Mol Pharmacol. 2000 Nov;58(5):877-86. | ||||
Ref 525893 | Autoradiographic localization of 5-HT(2A) receptors in the human brain using [(3)H]M100907 and [(11)C]M100907. Synapse. 2000 Dec 15;38(4):421-31. | ||||
Ref 525927 | Effect of ring fluorination on the pharmacology of hallucinogenic tryptamines. J Med Chem. 2000 Nov 30;43(24):4701-10. | ||||
Ref 525929 | Evidence for possible involvement of 5-HT(2B) receptors in the cardiac valvulopathy associated with fenfluramine and other serotonergic medications. Circulation. 2000 Dec 5;102(23):2836-41. | ||||
Ref 525940 | Bioorg Med Chem Lett. 2000 Dec 18;10(24):2701-3.3-(4-Piperidinyl)- and 3-(8-aza-bicyclo[3.2.1]oct-3-yl)-2-phenyl-1H-indoles as bioavailable h5-HT2A antagonists. | ||||
Ref 525963 | J Med Chem. 2001 Feb 15;44(4):477-501.Current and novel approaches to the drug treatment of schizophrenia. | ||||
Ref 525993 | Bioorg Med Chem Lett. 2001 Feb 26;11(4):563-6.Exploring the relationship between binding modes of 9-(aminomethyl)-9,10-dihydroanthracene and cyproheptadine analogues at the 5-HT2A serotonin receptor. | ||||
Ref 526055 | Bioorg Med Chem Lett. 2001 May 7;11(9):1229-31.Influence of the terminal amide fragment geometry in some 3-arylideneindolin-2(1H)-ones on their 5-HT1A/5-HT2A receptor activity. | ||||
Ref 526235 | Bioorg Med Chem Lett. 2002 Jan 21;12(2):155-8.Evaluation of isotryptamine derivatives at 5-HT(2) serotonin receptors. | ||||
Ref 526321 | J Nat Prod. 2002 Apr;65(4):476-80.New antiinfective and human 5-HT2 receptor binding natural and semisynthetic compounds from the Jamaican sponge Smenospongia aurea. | ||||
Ref 526510 | Affinity of cyamemazine, an anxiolytic antipsychotic drug, for human recombinant dopamine vs. serotonin receptor subtypes. Biochem Pharmacol. 2003 Feb 1;65(3):435-40. | ||||
Ref 526713 | J Med Chem. 2003 Sep 11;46(19):4188-95.A novel and selective 5-HT2 receptor agonist with ocular hypotensive activity: (S)-(+)-1-(2-aminopropyl)-8,9-dihydropyrano[3,2-e]indole. | ||||
Ref 526792 | Pharmacological profile of the new potent neuroleptic ocaperidone (R 79,598). J Pharmacol Exp Ther. 1992 Jan;260(1):146-59. | ||||
Ref 526899 | Bioorg Med Chem Lett. 2003 Dec 15;13(24):4421-5.Binding of beta-carbolines at 5-HT(2) serotonin receptors. | ||||
Ref 526959 | J Med Chem. 1992 Dec 25;35(26):4903-10.Ketanserin analogues: structure-affinity relationships for 5-HT2 and 5-HT1C serotonin receptor binding. | ||||
Ref 527037 | Bioorg Med Chem Lett. 2004 May 3;14(9):2367-70.Indoline derivatives as 5-HT(2C) receptor agonists. | ||||
Ref 527053 | Effects of EGIS-7625, a selective and competitive 5-HT2B receptor antagonist. Cardiovasc Drugs Ther. 2003 Sep-Nov;17(5-6):427-34. | ||||
Ref 527134 | Aripiprazole: a review of its use in schizophrenia and schizoaffective disorder. Drugs. 2004;64(15):1715-36. | ||||
Ref 527178 | Pharmacological characterisation of the agonist radioligand binding site of 5-HT(2A), 5-HT(2B) and 5-HT(2C) receptors. Naunyn Schmiedebergs Arch Pharmacol. 2004 Aug;370(2):114-23. Epub 2004 Jul 30. | ||||
Ref 527668 | Bioorg Med Chem Lett. 2005 Oct 15;15(20):4555-9.SAR of psilocybin analogs: discovery of a selective 5-HT 2C agonist. | ||||
Ref 527799 | J Med Chem. 2005 Oct 20;48(21):6523-43.Designed multiple ligands. An emerging drug discovery paradigm. | ||||
Ref 527833 | Bioorg Med Chem Lett. 2006 Feb;16(3):677-80. Epub 2005 Oct 27.Pyrrolo(iso)quinoline derivatives as 5-HT(2C) receptor agonists. | ||||
Ref 527952 | J Med Chem. 2006 Jan 12;49(1):318-28.1-((S)-2-aminopropyl)-1H-indazol-6-ol: a potent peripherally acting 5-HT2 receptor agonist with ocular hypotensive activity. | ||||
Ref 528294 | J Med Chem. 2006 Jul 13;49(14):4269-74.C-(4,5,6-trimethoxyindan-1-yl)methanamine: a mescaline analogue designed using a homology model of the 5-HT2A receptor. | ||||
Ref 528433 | J Med Chem. 2006 Sep 21;49(19):5794-803.1-Aminomethylbenzocycloalkanes: conformationally restricted hallucinogenic phenethylamine analogues as functionally selective 5-HT2A receptor agonists. | ||||
Ref 528498 | J Nat Prod. 2006 Oct;69(10):1421-4.Brominated cyclodipeptides from the marine sponge Geodia barretti as selective 5-HT ligands. | ||||
Ref 528625 | Bioorg Med Chem Lett. 2007 Mar 15;17(6):1708-12. Epub 2006 Dec 23.Synthesis and QSAR studies on hypotensive 1-[3-(4-substituted phenylthio) propyl]-4-(substituted phenyl) piperazines. | ||||
Ref 528638 | Bioorg Med Chem Lett. 2007 Mar 15;17(6):1570-4. Epub 2007 Jan 8.Synthesis and in vitro binding studies of substituted piperidine naphthamides. Part II: Influence of the substitution on the benzyl moiety on the affinity for D2L, D4.2, and 5-HT2A receptors. | ||||
Ref 528639 | Bioorg Med Chem Lett. 2007 Mar 15;17(6):1565-9. Epub 2007 Jan 8.Synthesis and in vitro binding studies of substituted piperidine naphthamides. Part I: Influence of the substitution on the basic nitrogen and the position of the amide on the affinity for D2L, D4.2, and 5-HT2A receptors. | ||||
Ref 528644 | Modeling of brain D2 receptor occupancy-plasma concentration relationships with a novel antipsychotic, YKP1358, using serial PET scans in healthy volunteers. Clin Pharmacol Ther. 2007 Feb;81(2):252-8. | ||||
Ref 528690 | Bioorg Med Chem Lett. 2007 May 1;17(9):2643-8. Epub 2007 Feb 2.2,5-Disubstituted pyridines: the discovery of a novel series of 5-HT2A ligands. | ||||
Ref 528778 | Bioorg Med Chem Lett. 2007 Jun 1;17(11):2998-3002. Epub 2007 Mar 25.Novel benzodifuran analogs as potent 5-HT2A receptor agonists with ocular hypotensive activity. | ||||
Ref 528956 | Structure-activity relationship study on N-(1,2,3,4-tetrahydronaphthalen-1-yl)-4-aryl-1-piperazinehexanamides, a class of 5-HT7 receptor agents. 2. J Med Chem. 2007 Aug 23;50(17):4214-21. Epub 2007 Jul 25. | ||||
Ref 528974 | J Med Chem. 2007 Aug 23;50(17):4135-46. Epub 2007 Aug 2.Heterocyclic analogues of N-(4-(4-(2,3-dichlorophenyl)piperazin-1-yl)butyl)arylcarboxamides with functionalized linking chains as novel dopamine D3 receptor ligands: potential substance abuse therapeutic agents. | ||||
Ref 529013 | Bioorg Med Chem. 2007 Nov 1;15(21):6659-66. Epub 2007 Aug 15.The synthesis and biological activity of pentafluorosulfanyl analogs of fluoxetine, fenfluramine, and norfenfluramine. | ||||
Ref 529128 | Bioorg Med Chem Lett. 2007 Dec 15;17(24):6691-6. Epub 2007 Oct 22.Design and synthesis of a functionally selective D3 agonist and its in vivo delivery via the intranasal route. | ||||
Ref 529148 | Bioorg Med Chem Lett. 2008 Jan 1;18(1):256-61. Epub 2007 Oct 30.Cyclic guanidines as dual 5-HT5A/5-HT7 receptor ligands: structure-activity relationship elucidation. | ||||
Ref 529168 | Bioorg Med Chem. 2008 Feb 15;16(4):1966-82. Epub 2007 Nov 4.Synthesis and structure-activity relationships of a series of substituted 2-(1H-furo[2,3-g]indazol-1-yl)ethylamine derivatives as 5-HT2C receptor agonists. | ||||
Ref 529191 | Bioorg Med Chem Lett. 2008 Jan 15;18(2):738-43. Epub 2007 Nov 17.Discovery of 3-aryl-3-methyl-1H-quinoline-2,4-diones as a new class of selective 5-HT6 receptor antagonists. | ||||
Ref 529221 | Bioorg Med Chem. 2008 Mar 15;16(6):3309-20. Epub 2007 Dec 8.Synthesis and structure-activity relationships of a series of benzazepine derivatives as 5-HT2C receptor agonists. | ||||
Ref 529336 | Bioorg Med Chem. 2008 Apr 15;16(8):4661-9. Epub 2008 Feb 14.The role of lipophilicity in determining binding affinity and functional activity for 5-HT2A receptor ligands. | ||||
Ref 529463 | Bioorg Med Chem. 2008 Jun 1;16(11):6242-51. Epub 2008 May 6.'Hybrid' benzofuran-benzopyran congeners as rigid analogs of hallucinogenic phenethylamines. | ||||
Ref 529672 | Bioorg Med Chem Lett. 2008 Oct 1;18(19):5268-71. Epub 2008 Aug 22.Methoxy-substituted 9-aminomethyl-9,10-dihydroanthracene (AMDA) derivatives exhibit differential binding affinities at the 5-HT(2A) receptor. | ||||
Ref 529686 | Bioorg Med Chem. 2008 Sep 15;16(18):8335-8. Epub 2008 Aug 28.N-Propylnoraporphin-11-O-yl carboxylic esters as potent dopamine D(2) and serotonin 5-HT(1A) receptor dual ligands. | ||||
Ref 529789 | J Med Chem. 2008 Nov 27;51(22):7094-8.cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain responses against carrageenan-induced hyperalgesia. | ||||
Ref 530045 | Bioorg Med Chem. 2009 Apr 15;17(8):2989-3002. Epub 2009 Mar 14.Synthesis and in vitro affinities of various MDL 100907 derivatives as potential 18F-radioligands for 5-HT2A receptor imaging with PET. | ||||
Ref 530209 | Bioorg Med Chem. 2009 Jul 15;17(14):5153-63. Epub 2009 May 29.Novel 1-aminoethyl-3-arylsulfonyl-1H-pyrrolo[2,3-b]pyridines are potent 5-HT(6) agonists. | ||||
Ref 530331 | Bioorg Med Chem. 2009 Sep 15;17(18):6496-504. Epub 2009 Aug 13.Synthesis, structure-affinity relationships, and modeling of AMDA analogs at 5-HT2A and H1 receptors: structural factors contributing to selectivity. | ||||
Ref 530451 | J Med Chem. 2009 Nov 12;52(21):6946-50.Novel, potent, and selective quinoxaline-based 5-HT(3) receptor ligands. 1. Further structure-activity relationships and pharmacological characterization. | ||||
Ref 530516 | Bioorg Med Chem Lett. 2010 Jan 1;20(1):266-71. Epub 2009 Oct 30.Design and synthesis of orally-active and selective azaindane 5HT2c agonist for the treatment of obesity. | ||||
Ref 530558 | Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. Epub 2009 Nov 20.Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. | ||||
Ref 530589 | Bioorg Med Chem Lett. 2010 Feb 1;20(3):1128-33. Epub 2009 Dec 6.Tricyclic dihydroquinazolinones as novel 5-HT2C selective and orally efficacious anti-obesity agents. | ||||
Ref 530613 | Bioorg Med Chem Lett. 2010 Feb 1;20(3):935-8. Epub 2009 Dec 23.9-Aminomethyl-9,10-dihydroanthracene (AMDA) analogs as structural probes for steric tolerance in 5-HT2A and H1 receptor binding sites. | ||||
Ref 530859 | Pharmacological profile of lurasidone, a novel antipsychotic agent with potent 5-hydroxytryptamine 7 (5-HT7) and 5-HT1A receptor activity. J Pharmacol Exp Ther. 2010 Jul;334(1):171-81. | ||||
Ref 530927 | J Med Chem. 2010 Jun 24;53(12):4803-7.Discovery of bishomo(hetero)arylpiperazines as novel multifunctional ligands targeting dopamine D(3) and serotonin 5-HT(1A) and 5-HT(2A) receptors. | ||||
Ref 531079 | J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential. | ||||
Ref 533252 | 5-Hydroxytryptamine2 receptor antagonist activity of the acid metabolite (1-isopropyl dihydrolysergic acid) of the ergoline ester, sergolexole (LY281067). J Pharmacol Exp Ther. 1989 Dec;251(3):1006-11. | ||||
Ref 533340 | Mechanism of the antihypertensive effect of FCE 22716, a new ergoline derivative, in the spontaneously hypertensive rat. Pharmacology. 1989;38(2):78-92. | ||||
Ref 533378 | J Med Chem. 1987 Nov;30(11):2099-104.2-Phenylpyrroles as conformationally restricted benzamide analogues. A new class of potential antipsychotics. 1. | ||||
Ref 533476 | J Med Chem. 1986 May;29(5):630-4.Synthesis and evaluation of phenyl- and benzoylpiperazines as potential serotonergic agents. | ||||
Ref 533482 | J Med Chem. 1986 Nov;29(11):2375-80.5-HT1 and 5-HT2 binding characteristics of some quipazine analogues. | ||||
Ref 533498 | J Med Chem. 1986 Feb;29(2):194-9.5-HT1 and 5-HT2 binding characteristics of 1-(2,5-dimethoxy-4-bromophenyl)-2-aminopropane analogues. | ||||
Ref 533501 | J Med Chem. 1985 Oct;28(10):1540-2.Resolution and absolute configuration of the potent dopamine agonist N,N-diethyl-N'-[(3 alpha, 4a alpha, 10a beta)-1,2,3,4,4a,5,10,10a- -octahydro-6-hydroxy-1-propyl-3-benzo[g]quinolinyl]sulfamide. | ||||
Ref 533800 | J Med Chem. 1994 Apr 15;37(8):1060-2.A new arylpiperazine antipsychotic with high D2/D3/5-HT1A/alpha 1A-adrenergic affinity and a low potential for extrapyramidal effects. | ||||
Ref 533873 | J Med Chem. 1994 Aug 19;37(17):2754-60.Structure-activity relationship studies of central nervous system agents. 13. 4-[3-(Benzotriazol-1-yl)propyl]-1-(2-methoxyphenyl)piperazine, a new putative 5-HT1A receptor antagonist, and its analogs. | ||||
Ref 533896 | Serotonergic (5-HT2) mediation of anxiety-therapeutic effects of serazepine in generalized anxiety disorder. Biol Psychiatry. 1993 Jul 1-15;34(1-2):41-4. | ||||
Ref 533905 | Species variations in transmembrane region V of the 5-hydroxytryptamine type 2A receptor alter the structure-activity relationship of certain ergolines and tryptamines. Mol Pharmacol. 1994 Feb;45(2):277-86. | ||||
Ref 533907 | Effects of the serotonin antagonist amesergide on reproduction in female rats. Reprod Toxicol. 1993 Nov-Dec;7(6):607-12. | ||||
Ref 534046 | Autoradiographic studies of RP 62203, a potent 5-HT2 receptor antagonist. Pharmacological characterization of [3H]RP 62203 binding in the rat brain. Eur J Pharmacol. 1993 Mar 16;233(1):37-45. | ||||
Ref 534052 | J Med Chem. 1993 Apr 30;36(9):1194-202.New indole derivatives as potent and selective serotonin uptake inhibitors. | ||||
Ref 534093 | J Med Chem. 1996 Jan 5;39(1):143-8.3-Benzisothiazolylpiperazine derivatives as potential atypical antipsychotic agents. | ||||
Ref 534136 | Mapping the binding site pocket of the serotonin 5-Hydroxytryptamine2A receptor. Ser3.36(159) provides a second interaction site for the protonated amine of serotonin but not of lysergic acid diethylamide or bufotenin. J Biol Chem. 1996 Jun 21;271(25):14672-5. | ||||
Ref 534232 | A novel class of 5-HT2A receptor antagonists: aryl aminoguanidines. Life Sci. 1996;59(15):1259-68. | ||||
Ref 534281 | Risperidone compared with new and reference antipsychotic drugs: in vitro and in vivo receptor binding. Psychopharmacology (Berl). 1996 Mar;124(1-2):57-73. | ||||
Ref 534323 | Visualisation of loss of 5-HT2A receptors with age in healthy volunteers using [18F]altanserin and positron emission tomographic imaging. Psychiatry Res. 1996 Nov 25;68(1):11-22. | ||||
Ref 534428 | SB 242084, a selective and brain penetrant 5-HT2C receptor antagonist. Neuropharmacology. 1997 Apr-May;36(4-5):609-20. | ||||
Ref 534475 | SB-216641 and BRL-15572--compounds to pharmacologically discriminate h5-HT1B and h5-HT1D receptors. Naunyn Schmiedebergs Arch Pharmacol. 1997 Sep;356(3):312-20. | ||||
Ref 534532 | J Med Chem. 1997 Dec 5;40(25):4146-53.Synthesis and pharmacological evaluation of triflate-substituted analogues of clozapine: identification of a novel atypical neuroleptic. | ||||
Ref 534609 | Deramciclane, a putative anxiolytic drug, is a serotonin 5-HT2C receptor inverse agonist but fails to induce 5-HT2C receptor down-regulation. Psychopharmacology (Berl). 1998 Mar;136(2):99-104. | ||||
Ref 534830 | Comparisons of hallucinogenic phenylisopropylamine binding affinities at cloned human 5-HT2A, -HT(2B) and 5-HT2C receptors. Naunyn Schmiedebergs Arch Pharmacol. 1999 Jan;359(1):1-6. | ||||
Ref 534942 | Synthesis and SAR of adatanserin: novel adamantyl aryl- and heteroarylpiperazines with dual serotonin 5-HT(1A) and 5-HT(2) activity as potential anxiolytic and antidepressant agents. J Med Chem. 1999Dec 16;42(25):5077-94. | ||||
Ref 535134 | Antagonism of 5-hydroxytryptamine(2a) receptors attenuates the behavioral effects of cocaine in rats. J Pharmacol Exp Ther. 2001 Apr;297(1):357-63. | ||||
Ref 535896 | The fenfluramine metabolite (+)-norfenfluramine is vasoactive. J Pharmacol Exp Ther. 2004 May;309(2):845-52. Epub 2004 Jan 29. | ||||
Ref 535927 | Some studies on the 5-hydroxytryptamine receptors in the isolated rat uterus. Afr J Med Med Sci. 2002 Dec;31(4):361-5. | ||||
Ref 535964 | Effects of R-102444, an orally active 5-HT2A receptor antagonist, in rat models of peripheral vascular disease. Vascul Pharmacol. 2004 Feb;41(1):7-13. | ||||
Ref 536286 | Serotonin reuptake inhibitors: the corner stone in treatment of depression for half a century--a medicinal chemistry survey. Curr Top Med Chem. 2006;6(17):1801-23. | ||||
Ref 536352 | The 5-hydroxytryptamine2A receptor is involved in (+)-norfenfluramine-induced arterial contraction and blood pressure increase in deoxycorticosterone acetate-salt hypertension. J Pharmacol Exp Ther. 2007 May;321(2):485-91. Epub 2007 Feb 8. | ||||
Ref 536463 | The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. Epub 2007 Jul 31. | ||||
Ref 536580 | Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. Epub 2008 Jan 2. | ||||
Ref 536752 | Human embryonic stem cell-derived oligodendrocyte progenitor cells express the serotonin receptor and are susceptible to JC virus infection. J Virol. 2008 Sep;82(17):8896-9. Epub 2008 Jun 25. | ||||
Ref 536787 | Characterization of contractile 5-hydroxytryptamine receptor subtypes in the in situ autoperfused kidney in the anaesthetized rat. Eur J Pharmacol. 2008 Sep 11;592(1-3):133-7. Epub 2008 Jul 4. | ||||
Ref 537172 | Acute effects of sarpogrelate, a 5-HT2A receptor antagonist on cytokine production in endotoxin shock model of rats. Eur J Pharmacol. 2009 Jul 1;614(1-3):122-7. Epub 2009 Mar 24. | ||||
Ref 537535 | Beneficial effects of sarpogrelate hydrochloride, a 5-HT2A receptor antagonist, supplemented with pioglitazone on diabetic model mice. Endocr Res. 2009;34(1-2):18-30. | ||||
Ref 537955 | Evidence that 5-HT2A receptors are not involved in 5-HT-mediated thermoregulation in mice. Pharmacol Biochem Behav. 1995 Dec;52(4):755-8. | ||||
Ref 538037 | Therapeutic effect of sarpogrelate, a new 5-hydroxytryptamine receptor 2A antagonist, on diabetic nephropathy and neuropathy. Nephron. 1997;76(2):227-9. | ||||
Ref 538116 | A potent 5-hydroxytryptamine receptor (5-HT2A) antagonist, DV-7028, delays arterial thrombosis development in rats. Thromb Res. 1998 Jun 15;90(6):259-70. | ||||
Ref 538117 | Vascular and cardiac effects of DV-7028, a selective, 5-HT2-receptor antagonist in rats. J Cardiovasc Pharmacol. 1998 Aug;32(2):266-73. | ||||
Ref 538142 | p-Chloroamphetamine, a serotonin-releasing drug, elicited in rats a hyperglycemia mediated by the 5-HT1A and 5-HT2B/2C receptors. Eur J Pharmacol. 1998 Oct 23;359(2-3):185-90. | ||||
Ref 543891 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 6). | ||||
Ref 544111 | Bi-directional modulation of BNST neurons by 5-HT: Molecular expression and functional properties of excitatory 5-HT receptor subtypes. Neuroscience. 2009 December 29; 164(4): 1776-1793. | ||||
Ref 544175 | Novel ocular antihypertensive compounds in clinical trials. Clin Ophthalmol. 2011; 5: 667-677. | ||||
Ref 550651 | Pharmacological characteristics of ATI-9242, a Novel Atypical Antipsychotic. FASEB J, April, 2010, 24(Meeting Abstract Supplement),773.12. | ||||
Ref 551041 | Clinical pipeline report, company report or official report of Intra-Cellular Therapies, Inc. | ||||
Ref 551219 | Synthesis and structure-affinity relationships of novel small molecule natural product derivatives capable of discriminating between serotonin 5-HT1A, 5-HT2A, 5-HT2C receptor subtypes. Bioorg Med Chem. 2010 Jul 1;18(13):4783-92. doi: 10.1016/j.bmc.2010.05.017. Epub 2010 May 15. | ||||
Ref 551319 | 4-(3-furyl)-2-(4-methylpiperazino)pyrimidines: Potent 5-HT2A receptor antagonists, Bioorg. Med. Chem. Lett. 7(13):1635-1638 (1997). | ||||
Ref 551334 | Regioselective synthesis of 3-aryl substituted pyrrolidines via palladium catalyzed arylation: pharmacological evaluation for central dopaminergic and serotonergic activity, Bioorg. Med. Chem. Lett. 7(3):241-246 (1997). | ||||
Ref 551382 | The origin of <span class="caps">MDMA</span> (ecstasy) revisited: the true story reconstructed from the original documents. Addiction. 2006 Sep;101(9):1241-5. | ||||
Ref 551390 | Anxiolytic effects of aniracetam in three different mouse models of anxiety and the underlying mechanism. Eur J Pharmacol. 2001 May 18;420(1):33-43. | ||||
Ref 551401 | Dose-response study of N,N-dimethyltryptamine in humans. I. Neuroendocrine, autonomic, and cardiovascular effects. Arch Gen Psychiatry. 1994 Feb;51(2):85-97. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.