Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T50912
|
||||
Former ID |
TTDS00490
|
||||
Target Name |
T-lymphocyte activation antigen CD86
|
||||
Gene Name |
CD86
|
||||
Synonyms |
Activation B7-2 antigen; B70; BU63; CD28LG2; CTLA-4 counter-receptor B7.2; FUN-1; CD86
|
||||
Target Type |
Successful
|
||||
Disease | Autoimmune diabetes [ICD10: E08-E13] | ||||
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
Transplant rejection [ICD9: 279.5, 996; ICD10: D89.8, T86] | |||||
Function |
Receptor involved in the costimulatory signal essential for t-lymphocyte proliferation and interleukin-2 production, by binding cd28 or ctla-4. May play a critical role in the early events of t-cell activation and costimulationof naive t-cells, such as deciding between immunity and anergy that is made by t-cells within 24 hours after activation. Isoform 2 interferes with the formation of cd86 clusters, and thus acts as a negative regulator of t-cell activation.
|
||||
BioChemical Class |
Immunoglobulin
|
||||
Target Validation |
T50912
|
||||
UniProt ID | |||||
Sequence |
MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQ
ENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGM IRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTI EYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQ PPPDHIPWITAVLPTVIICVMVFCLILWKWKKKKRPRNSYKCGTNTMEREESEQTKKREK IHIPERSDEAQRVFKSSKTSSCDKSDTCF |
||||
Structure |
1I85; 1NCN
|
||||
Drugs and Mode of Action | |||||
Drug(s) | Abatacept | Drug Info | Approved | Rheumatoid arthritis | [1], [2] |
MAXY-4 | Drug Info | Phase 1 | Autoimmune diabetes | [3] | |
Tolerimab (anti-CD80/CD86) | Drug Info | Terminated | Transplant rejection | [4] | |
Binder | Abatacept | Drug Info | [5] | ||
Inhibitor | MAXY-4 | Drug Info | [6] | ||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Cell adhesion molecules (CAMs) | ||||
Toll-like receptor signaling pathway | |||||
Intestinal immune network for IgA production | |||||
Type I diabetes mellitus | |||||
Transcriptional misregulation in cancer | |||||
Autoimmune thyroid disease | |||||
Systemic lupus erythematosus | |||||
Rheumatoid arthritis | |||||
Allograft rejection | |||||
Graft-versus-host disease | |||||
Viral myocarditis | |||||
NetPath Pathway | TCR Signaling Pathway | ||||
IL3 Signaling Pathway | |||||
IL4 Signaling Pathway | |||||
RANKL Signaling Pathway | |||||
PANTHER Pathway | T cell activation | ||||
Pathway Interaction Database | TCR signaling in na& | ||||
#xef | |||||
ve CD4+ T cells | |||||
TCR signaling in na& | |||||
ve CD8+ T cells | |||||
IL12 signaling mediated by STAT4 | |||||
Reactome | PIP3 activates AKT signaling | ||||
Constitutive Signaling by Aberrant PI3K in Cancer | |||||
CD28 co-stimulation | |||||
CD28 dependent PI3K/Akt signaling | |||||
CD28 dependent Vav1 pathway | |||||
CTLA4 inhibitory signaling | |||||
WikiPathways | Toll-like receptor signaling pathway | ||||
Inflammatory Response Pathway | |||||
IL-3 Signaling Pathway | |||||
PIP3 activates AKT signaling | |||||
Allograft Rejection | |||||
Costimulation by the CD28 family | |||||
Regulation of toll-like receptor signaling pathway | |||||
References | |||||
REF 1 | Emerging drugs for idiopathic thrombocytopenic purpura in adults. Expert Opin Emerg Drugs. 2008 Jun;13(2):237-54. | ||||
REF 2 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6891). | ||||
REF 3 | ClinicalTrials.gov (NCT02052375) A Study To Evaluate the Pharmacokinetics, Pharmacodynamics, Safety and Tolerability of ASP2408 After Multiple Dose Subcutaneous Injections in Patients With RheumatoidArthritis on Methotrexate. U.S. National Institutes of Health. | ||||
REF 4 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011393) | ||||
REF 5 | Selective modulation of T-cell co-stimulation: a novel mode of action for the treatment of rheumatoid arthritis. Clin Exp Rheumatol. 2009 May-Jun;27(3):510-8. | ||||
REF 6 | Trans-endocytosis of CD80 and CD86: a molecular basis for the cell-extrinsic function of CTLA-4. Science. 2011 Apr 29;332(6029):600-3. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.