Target General Infomation
Target ID
T50912
Former ID
TTDS00490
Target Name
T-lymphocyte activation antigen CD86
Gene Name
CD86
Synonyms
Activation B7-2 antigen; B70; BU63; CD28LG2; CTLA-4 counter-receptor B7.2; FUN-1; CD86
Target Type
Successful
Disease Autoimmune diabetes [ICD10: E08-E13]
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06]
Transplant rejection [ICD9: 279.5, 996; ICD10: D89.8, T86]
Function
Receptor involved in the costimulatory signal essential for t-lymphocyte proliferation and interleukin-2 production, by binding cd28 or ctla-4. May play a critical role in the early events of t-cell activation and costimulationof naive t-cells, such as deciding between immunity and anergy that is made by t-cells within 24 hours after activation. Isoform 2 interferes with the formation of cd86 clusters, and thus acts as a negative regulator of t-cell activation.
BioChemical Class
Immunoglobulin
Target Validation
T50912
UniProt ID
Sequence
MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQ
ENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGM
IRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTI
EYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQ
PPPDHIPWITAVLPTVIICVMVFCLILWKWKKKKRPRNSYKCGTNTMEREESEQTKKREK
IHIPERSDEAQRVFKSSKTSSCDKSDTCF
Structure
1I85; 1NCN
Drugs and Mode of Action
Drug(s) Abatacept Drug Info Approved Rheumatoid arthritis [1], [2]
MAXY-4 Drug Info Phase 1 Autoimmune diabetes [3]
Tolerimab (anti-CD80/CD86) Drug Info Terminated Transplant rejection [4]
Binder Abatacept Drug Info [5]
Inhibitor MAXY-4 Drug Info [6]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Cell adhesion molecules (CAMs)
Toll-like receptor signaling pathway
Intestinal immune network for IgA production
Type I diabetes mellitus
Transcriptional misregulation in cancer
Autoimmune thyroid disease
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis
NetPath Pathway TCR Signaling Pathway
IL3 Signaling Pathway
IL4 Signaling Pathway
RANKL Signaling Pathway
PANTHER Pathway T cell activation
Pathway Interaction Database TCR signaling in na&amp
#xef
ve CD4+ T cells
TCR signaling in na&amp
ve CD8+ T cells
IL12 signaling mediated by STAT4
Reactome PIP3 activates AKT signaling
Constitutive Signaling by Aberrant PI3K in Cancer
CD28 co-stimulation
CD28 dependent PI3K/Akt signaling
CD28 dependent Vav1 pathway
CTLA4 inhibitory signaling
WikiPathways Toll-like receptor signaling pathway
Inflammatory Response Pathway
IL-3 Signaling Pathway
PIP3 activates AKT signaling
Allograft Rejection
Costimulation by the CD28 family
Regulation of toll-like receptor signaling pathway
References
REF 1Emerging drugs for idiopathic thrombocytopenic purpura in adults. Expert Opin Emerg Drugs. 2008 Jun;13(2):237-54.
REF 2(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6891).
REF 3ClinicalTrials.gov (NCT02052375) A Study To Evaluate the Pharmacokinetics, Pharmacodynamics, Safety and Tolerability of ASP2408 After Multiple Dose Subcutaneous Injections in Patients With RheumatoidArthritis on Methotrexate. U.S. National Institutes of Health.
REF 4Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011393)
REF 5Selective modulation of T-cell co-stimulation: a novel mode of action for the treatment of rheumatoid arthritis. Clin Exp Rheumatol. 2009 May-Jun;27(3):510-8.
REF 6Trans-endocytosis of CD80 and CD86: a molecular basis for the cell-extrinsic function of CTLA-4. Science. 2011 Apr 29;332(6029):600-3.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.