| Target General Infomation |
| Target ID |
T91149
|
| Former ID |
TTDR01431
|
| Target Name |
mRNA of AkT-3
|
| Gene Name |
AKT3
|
| Synonyms |
PKB gamma (mRNA); Protein kinase Akt-3 (mRNA); Protein kinase B gamma (mRNA); RAC-PK-gamma (mRNA); RAC-gamma serine/threonine-protein kinase (mRNA); STK-2 (mRNA); AKT3
|
| Target Type |
Research
|
| Function |
AKT3 is one of 3 closely related serine/threonine- protein kinases (AKT1, AKT2 and AKT3) called the AKT kinase, and which regulate many processes including metabolism, proliferation, cell survival, growth and angiogenesis. This is mediated through serine and/or threonine phosphorylation of a range of downstream substrates. Over 100 substrate candidates have been reported so far, but for most of them, no isoform specificity has been reported. AKT3 is the least studied AKT isoform. It plays an important role in brain development and is crucial for the viability of malignant glioma cells. AKT3 isoform may also be the key molecule in up-regulation anddown-regulation of MMP13 via IL13. Required for the coordination of mitochondrial biogenesis with growth factor-induced increases in cellular energy demands. Down-regulation by RNA interference reduces the expression of the phosphorylated form of BAD, resulting in the induction of caspase- dependent apoptosis.
|
| BioChemical Class |
Kinase
|
| Target Validation |
T91149
|
| UniProt ID |
|
| EC Number |
EC 2.7.11.1
|
| Sequence |
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
|
| Inhibitor |
SB-747651A |
Drug Info |
[1] |
|---|
| Pathways |
|
KEGG Pathway
|
MAPK signaling pathway
|
|
ErbB signaling pathway
|
|
Ras signaling pathway
|
|
Rap1 signaling pathway
|
|
cGMP-PKG signaling pathway
|
|
cAMP signaling pathway
|
|
Chemokine signaling pathway
|
|
HIF-1 signaling pathway
|
|
FoxO signaling pathway
|
|
Sphingolipid signaling pathway
|
|
mTOR signaling pathway
|
|
PI3K-Akt signaling pathway
|
|
AMPK signaling pathway
|
|
Apoptosis
|
|
Adrenergic signaling in cardiomyocytes
|
|
VEGF signaling pathway
|
|
Osteoclast differentiation
|
|
Focal adhesion
|
|
Tight junction
|
|
Signaling pathways regulating pluripotency of stem cells
|
|
Platelet activation
|
|
Toll-like receptor signaling pathway
|
|
Jak-STAT signaling pathway
|
|
T cell receptor signaling pathway
|
|
B cell receptor signaling pathway
|
|
Fc epsilon RI signaling pathway
|
|
Fc gamma R-mediated phagocytosis
|
|
TNF signaling pathway
|
|
Neurotrophin signaling pathway
|
|
Cholinergic synapse
|
|
Dopaminergic synapse
|
|
Insulin signaling pathway
|
|
Progesterone-mediated oocyte maturation
|
|
Estrogen signaling pathway
|
|
Prolactin signaling pathway
|
|
Thyroid hormone signaling pathway
|
|
Adipocytokine signaling pathway
|
|
Glucagon signaling pathway
|
|
Regulation of lipolysis in adipocytes
|
|
Non-alcoholic fatty liver disease (NAFLD)
|
|
Carbohydrate digestion and absorption
|
|
Chagas disease (American trypanosomiasis)
|
|
Toxoplasmosis
|
|
Tuberculosis
|
|
Hepatitis C
|
|
Hepatitis B
|
|
Measles
|
|
Influenza A
|
|
HTLV-I infection
|
|
Epstein-Barr virus infection
|
|
Pathways in cancer
|
|
Proteoglycans in cancer
|
|
Colorectal cancer
|
|
Renal cell carcinoma
|
|
Pancreatic cancer
|
|
Endometrial cancer
|
|
Glioma
|
|
Prostate cancer
|
|
Melanoma
|
|
Chronic myeloid leukemia
|
|
Acute myeloid leukemia
|
|
Small cell lung cancer
|
|
Non-small cell lung cancer
|
|
Central carbon metabolism in cancer
|
|
Choline metabolism in cancer
|
|
NetPath Pathway
|
TSH Signaling Pathway
|
|
IL2 Signaling Pathway
|
|
PANTHER Pathway
|
Angiogenesis
|
|
Apoptosis signaling pathway
|
|
EGF receptor signaling pathway
|
|
Endothelin signaling pathway
|
|
FGF signaling pathway
|
|
Huntington disease
|
|
Hypoxia response via HIF activation
|
|
Inflammation mediated by chemokine and cytokine signaling pathway
|
|
Interleukin signaling pathway
|
|
PI3 kinase pathway
|
|
T cell activation
|
|
p53 pathway
|
|
Ras Pathway
|
|
p53 pathway by glucose deprivation
|
|
p53 pathway feedback loops 2
|
|
Pathway Interaction Database
|
S1P3 pathway
|
|
Class I PI3K signaling events mediated by Akt
|
|
Reactome
|
Activation of BAD and translocation to mitochondria
|
|
GPVI-mediated activation cascade
|
|
PIP3 activates AKT signaling
|
|
AKT phosphorylates targets in the cytosol
|
|
AKT phosphorylates targets in the nucleus
|
|
Negative regulation of the PI3K/AKT network
|
|
AKT-mediated inactivation of FOXO1A
|
|
CD28 dependent PI3K/Akt signaling
|
|
CTLA4 inhibitory signaling
|
|
gamma signalling through PI3Kgamma
|
|
VEGFR2 mediated vascular permeability
|
|
TP53 Regulates Metabolic Genes
|
|
Constitutive Signaling by AKT1 E17K in Cancer
|
|
WikiPathways
|
Toll-like receptor signaling pathway
|
|
DNA Damage Response (only ATM dependent)
|
|
ErbB Signaling Pathway
|
|
Nanoparticle-mediated activation of receptor signaling
|
|
Signal Transduction of S1P Receptor
|
|
Signaling Pathways in Glioblastoma
|
|
Integrin-mediated Cell Adhesion
|
|
Regulation of toll-like receptor signaling pathway
|
| References |
| REF 1 | J Med Chem. 2008 Sep 25;51(18):5663-79.Identification of 4-(2-(4-amino-1,2,5-oxadiazol-3-yl)-1-ethyl-7-{[(3S)-3-piperidinylmethyl]oxy}-1H-imidazo[4,5-c]pyridin-4-yl)-2-methyl-3-butyn-2-ol (GSK690693), a novel inhibitor of AKT kinase. |
|---|
