Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T70101
|
||||
| Former ID |
TTDR00956
|
||||
| Target Name |
CTP synthase
|
||||
| Gene Name |
CTPS1
|
||||
| Synonyms |
CTP synthetase; Cytidine 5'-triphosphate synthetase; Cytidine triphosphate synthetase; UTP--ammonia ligase; UTP:ammonia ligase (ADP-forming); Uridine triphosphate aminase; CTPS1
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | ||||
| Function |
This enzyme is involved in the de novo synthesis of CTP, a precursor of DNA, RNA and phospholipids. Catalyzes the ATP- dependent amination of UTP to CTP with either L-glutamine or ammonia as a source of nitrogen. This enzyme and its product, CTP, play a crucial role in the proliferation of activated lymphocytes and therefore in immunity.
|
||||
| BioChemical Class |
Carbon-nitrogen ligase
|
||||
| UniProt ID | |||||
| EC Number |
EC 6.3.4.2
|
||||
| Sequence |
MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFV
LDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDA IQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHV SLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQ VICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCS IALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQK LCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDAN STEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRH RFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPY FGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Cyclopentenylcytosine | Drug Info | Phase 1 | Solid tumours | [1] |
| Acivicin | Drug Info | Discontinued in Phase 3 | Discovery agent | [2] | |
| Inhibitor | 2-Methyl-2,4-Pentanediol | Drug Info | [3] | ||
| Acivicin | Drug Info | [4], [5] | |||
| Carbodine | Drug Info | [6] | |||
| Cyclopentenylcytosine | Drug Info | [7] | |||
| Cyclopentylcytosine | Drug Info | [7] | |||
| Cylopentenyl cytosine | Drug Info | [8] | |||
| Pathways | |||||
| KEGG Pathway | Pyrimidine metabolism | ||||
| Metabolic pathways | |||||
| PANTHER Pathway | De novo pyrimidine ribonucleotides biosythesis | ||||
| PathWhiz Pathway | Pyrimidine Metabolism | ||||
| WikiPathways | Metabolism of nucleotides | ||||
| References | |||||
| REF 1 | Phase I clinical trial of continuous infusion cyclopentenyl cytosine. Cancer Chemother Pharmacol. 1995;36(6):513-23. | ||||
| REF 2 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000775) | ||||
| REF 3 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
| REF 4 | Trypanosoma brucei CTP synthetase: a target for the treatment of African sleeping sickness. Proc Natl Acad Sci U S A. 2001 May 22;98(11):6412-6. Epub 2001 May 15. | ||||
| REF 5 | Synergistic effects with inhibitors of de novo pyrimidine synthesis, acivicin, and N-(phosphonacetyl)-L-aspartic acid. Cancer Res. 1981 Sep;41(9 Pt 1):3419-23. | ||||
| REF 6 | Potent activity of 5-fluoro-2'-deoxyuridine and related compounds against thymidine kinase-deficient (TK-) herpes simplex virus: targeted at thymidylate synthase. Mol Pharmacol. 1987 Aug;32(1):286-92. | ||||
| REF 7 | Molecular approaches for the treatment of hemorrhagic fever virus infections. Antiviral Res. 1993 Sep;22(1):45-75. | ||||
| REF 8 | Comments on: cylopentenyl cytosine inhibits cytidine triphosphate synthetase in paediatric acute non-lymphocytic leukaemia: a promising target for chemotherapy. A.C. Verschuur et al. Eur J Cancer 2000, 36, 627-635. Eur J Cancer. 2001 Jan;37(2):290. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.