Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T29960
|
||||
| Former ID |
TTDR00688
|
||||
| Target Name |
Wilms' tumor protein
|
||||
| Gene Name |
WT1
|
||||
| Synonyms |
WT1 protein; WT33; Wilms' tumour 1 protein; WT1
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Acute myeloid leukemia [ICD9: 205; ICD10: C92.0] | ||||
| Acute myeloid leukemia; Lung cancer [ICD9:205, 162; ICD10: C92.0, C33-C34] | |||||
| Leukemia [ICD9: 208.9; ICD10: C90-C95] | |||||
| Myeloid leukemia [ICD9: 208.9; ICD10: C92] | |||||
| Function |
Potential role in transcriptional regulation. Recognizes and binds to the dna sequence 5'-cgcccccgc-3'.
|
||||
| BioChemical Class |
EGR C2H2-type zinc-finger
|
||||
| UniProt ID | |||||
| Sequence |
MGSDVRDLNALLPAVPSLGGGGGCALPVSGAAQWAPVLDFAPPGASAYGSLGGPAPPPAP
PPPPPPPPHSFIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPFGPPPPSQA SSGQARMFPNAPYLPSCLESQPAIRNQGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHED PMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQ MNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRIHTHGVFRGIQDV RRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDC ERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPS CQKKFARSDELVRHHNMHQRNMTKLQLAL |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Combined PR1/WT1 vaccine | Drug Info | Phase 2 | Myeloid leukemia | [1] |
| DNA vaccine | Drug Info | Phase 2 | Acute myeloid leukemia | [2] | |
| FPI-01 | Drug Info | Phase 2 | Acute myeloid leukemia | [3] | |
| WT1 peptide vaccine | Drug Info | Phase 2 | Leukemia | [4] | |
| WT1-targeted autologous dendritic cell vaccine | Drug Info | Phase 2 | Acute myeloid leukemia | [5] | |
| WT-4869 | Drug Info | Phase 1/2 | Leukemia | [6] | |
| GSK-2130579A | Drug Info | Phase 1 | Acute myeloid leukemia | [7] | |
| INNO-305 | Drug Info | Phase 1 | Acute myeloid leukemia; Lung cancer | [8] | |
| Modulator | INNO-305 | Drug Info | [9] | ||
| WT-4869 | Drug Info | [10] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Transcriptional misregulation in cancer | ||||
| NetPath Pathway | FSH Signaling Pathway | ||||
| IL5 Signaling Pathway | |||||
| Pathway Interaction Database | p73 transcription factor network | ||||
| Regulation of Telomerase | |||||
| WikiPathways | Primary Focal Segmental Glomerulosclerosis FSGS | ||||
| Integrated Pancreatic Cancer Pathway | |||||
| References | |||||
| REF 1 | Review of the Results of WT1 Peptide Vaccination Strategies for Myelodysplastic Syndromes and Acute Myeloid Leukemia from Nine Different Studies. Front Immunol. 2015 Feb 4;6:36. | ||||
| REF 2 | ClinicalTrials.gov (NCT01334060) WT1 Immunity Via DNA Fusion Gene Vaccination in Haematological Malignancies by Intramuscular Injection Followed by Intramuscular Electroporation. U.S. National Institutes of Health. | ||||
| REF 3 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800040574) | ||||
| REF 4 | ClinicalTrials.gov (NCT01266083) Trial of a WT-1 Analog Peptide Vaccine in Patients With Acute Myeloid Leukemia (AML) or Acute Lymphoblastic Leukemia (ALL). U.S. National Institutes of Health. | ||||
| REF 5 | ClinicalTrials.gov (NCT01686334) Efficacy Study of Dendritic Cell Vaccination in Patients With Acute Myeloid Leukemia in Remission. U.S. National Institutes of Health. | ||||
| REF 6 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033385) | ||||
| REF 7 | ClinicalTrials.gov (NCT01051063) Evaluation of a New Anti-cancer Immunotherapy in Adult Acute Myeloid Leukemia Patients With a Suboptimal Clinical Response to Induction Chemotherapy. U.S. National Institutes of Health. | ||||
| REF 8 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023753) | ||||
| REF 9 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023753) | ||||
| REF 10 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033385) | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.