Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T15882
|
||||
| Former ID |
TTDI02312
|
||||
| Target Name |
Leukocyte proteinase-3
|
||||
| Gene Name |
PRTN3
|
||||
| Synonyms |
AGP7; CANCA antigen; Leukocyte proteinase 3; Myeloblastin; NP4; Neutrophil proteinase 4; P29; PR3; Wegener autoantigen; PRTN3
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Myeloid leukemia [ICD9: 208.9; ICD10: C92] | ||||
| Myocardial infarction [ICD9: 410; ICD10: I21, I22] | |||||
| Function |
Polymorphonuclear leukocyte serine protease that degrades elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV (in vitro) and causes emphysema when administered by tracheal insufflation to hamsters.
|
||||
| BioChemical Class |
Peptidase
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.4.21.76
|
||||
| Sequence |
MAHRPPSPALASVLLALLLSGAARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTL
IHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVL LIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTF FCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYV DWIRSTLRRVEAKGRP |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Combined PR1/WT1 vaccine | Drug Info | Phase 2 | Myeloid leukemia | [1] |
| Tiprelestat | Drug Info | Phase 2 | Myocardial infarction | [2] | |
| Inhibitor | compound 4g | Drug Info | [3] | ||
| Modulator | Tiprelestat | Drug Info | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| Pathway Interaction Database | C-MYB transcription factor network | ||||
| Reactome | Common Pathway of Fibrin Clot Formation | ||||
| References | |||||
| REF 1 | Review of the Results of WT1 Peptide Vaccination Strategies for Myelodysplastic Syndromes and Acute Myeloid Leukemia from Nine Different Studies. Front Immunol. 2015 Feb 4;6:36. | ||||
| REF 2 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021706) | ||||
| REF 3 | N-Acyl and N-sulfonyloxazolidine-2,4-diones are pseudo-irreversible inhibitors of serine proteases. Bioorg Med Chem Lett. 2012 Jun 15;22(12):3993-7. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.