Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T76904
|
||||
Former ID |
TTDS00362
|
||||
Target Name |
Catechol-O-methyl-transferase
|
||||
Gene Name |
COMT
|
||||
Synonyms |
Catechol-O-methyltransferase; MB-COMT; S-COMT; COMT
|
||||
Target Type |
Successful
|
||||
Disease | Major depressive disorder [ICD9: 296.2, 296.3, 710.0; ICD10: F32, F33, M32] | ||||
Non-insulin dependent diabetes [ICD10: E11.9] | |||||
Parkinson's disease [ICD9: 332; ICD10: G20] | |||||
Parkinson's disease; Restless legs syndrome [ICD9: 332, 333.94; ICD10: F02.3, G20, G25.8] | |||||
Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
Schizophrenia [ICD9: 295; ICD10: F20] | |||||
Function |
Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol.
|
||||
BioChemical Class |
Methyltransferase superfamily
|
||||
Target Validation |
T76904
|
||||
UniProt ID | |||||
EC Number |
EC 2.1.1.6
|
||||
Sequence |
MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRIL
NHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCG YSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKY DVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFE CTHYQSFLEYREVVDGLEKAIYKGPGSEAGP |
||||
Drugs and Mode of Action | |||||
Drug(s) | Entacapone | Drug Info | Approved | Parkinson's disease | [536923], [541757] |
Tolcapone | Drug Info | Approved | Parkinson's disease | [536923], [541756] | |
Entacapone+levodopa+carbidopa | Drug Info | Phase 3 | Parkinson's disease; Restless legs syndrome | [544058] | |
Opicapone | Drug Info | Phase 3 | Parkinson's disease | [532159] | |
BIA 3-202 | Drug Info | Phase 2 | Parkinson's disease | [529342] | |
CGP-28014 | Drug Info | Phase 2 | Major depressive disorder | [530430] | |
PGX-200097 | Drug Info | Preclinical | Schizophrenia | [548315] | |
Nitecapone | Drug Info | Discontinued in Phase 2 | Pain | [544833] | |
Inhibitor | (3,4-DIHYDROXY-2-NITROPHENYL)(PHENYL)METHANONE | Drug Info | [551374] | ||
1-(3,4-dihydroxy-2-nitrophenyl)-2-phenylethanone | Drug Info | [527918] | |||
1-(3,4-dihydroxy-5-nitrophenyl)-2-phenoxyethanone | Drug Info | [527307] | |||
3,5-Dinitrocatechol | Drug Info | [551393] | |||
5,6-dihydroxy-7-nitro-2,3-dihydroinden-1-one | Drug Info | [527918] | |||
6,7-dihydroxy-8-nitro-1-tetralone | Drug Info | [527918] | |||
7,8-dihydroxy-4-phenyl-2H-chromen-2-one | Drug Info | [551374] | |||
BIA | Drug Info | [551374] | |||
BIA 3-202 | Drug Info | [535563] | |||
Entacapone | Drug Info | [535173], [535204] | |||
Entacapone+levodopa+carbidopa | Drug Info | [536121] | |||
Opicapone | Drug Info | [532159] | |||
PGX-200097 | Drug Info | [531048] | |||
Tolcapone | Drug Info | [534927], [535173] | |||
Modulator | CGP-28014 | Drug Info | [530430] | ||
Nitecapone | Drug Info | [531946] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
BioCyc Pathway | L-dopa degradation | ||||
Dopamine degradation | |||||
Noradrenaline and adrenaline degradation | |||||
KEGG Pathway | Steroid hormone biosynthesis | ||||
Tyrosine metabolism | |||||
Metabolic pathways | |||||
Dopaminergic synapse | |||||
PANTHER Pathway | Adrenaline and noradrenaline biosynthesis | ||||
Dopamine receptor mediated signaling pathway | |||||
PathWhiz Pathway | Tyrosine Metabolism | ||||
WikiPathways | Methylation Pathways | ||||
Metapathway biotransformation | |||||
Estrogen metabolism | |||||
Biogenic Amine Synthesis | |||||
Dopamine metabolism | |||||
Phase II conjugation | |||||
Neurotransmitter Clearance In The Synaptic Cleft | |||||
References | |||||
Ref 529342 | Effects of nebicapone on levodopa pharmacokinetics, catechol-O-methyltransferase activity, and motor fluctuations in patients with Parkinson disease. Clin Neuropharmacol. 2008 Jan-Feb;31(1):2-18. | ||||
Ref 530430 | CGP 28014, a new inhibitor of cerebral catechol-O-methylation with a non-catechol structure. Naunyn Schmiedebergs Arch Pharmacol. 1990 Sep;342(3):305-11. | ||||
Ref 532159 | Pharmacokinetics, pharmacodynamics and tolerability of opicapone, a novel catechol-O-methyltransferase inhibitor, in healthy subjects: prediction of slow enzyme-inhibitor complex dissociation of a short-living and very long-acting inhibitor. Clin Pharmacokinet. 2013 Feb;52(2):139-51. | ||||
Ref 536923 | Drugs used to treat Parkinson's disease, present status and future directions. CNS Neurol Disord Drug Targets. 2008 Oct;7(4):321-42. | ||||
Ref 541756 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6646). | ||||
Ref 541757 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6647). | ||||
Ref 544058 | Optimizing levodopa therapy for Parkinson's disease with levodopa/carbidopa/entacapone: implications from a clinical and patient perspective. Neuropsychiatr Dis Treat. 2008 February; 4(1): 39-47. | ||||
Ref 527307 | J Med Chem. 2004 Dec 2;47(25):6207-17.Synthesis, biological evaluation, and molecular modeling studies of a novel, peripherally selective inhibitor of catechol-O-methyltransferase. | ||||
Ref 527918 | J Med Chem. 2005 Dec 15;48(25):8070-8.Synthesis and biological evaluation of a novel series of "ortho-nitrated" inhibitors of catechol-O-methyltransferase. | ||||
Ref 530430 | CGP 28014, a new inhibitor of cerebral catechol-O-methylation with a non-catechol structure. Naunyn Schmiedebergs Arch Pharmacol. 1990 Sep;342(3):305-11. | ||||
Ref 531048 | Schizophrenia, "just the facts" 5. Treatment and prevention. Past, present, and future. Schizophr Res. 2010 Sep;122(1-3):1-23. | ||||
Ref 531946 | Effect of a novel catechol-O-methyltransferase inhibitor, nitecapone, on the metabolism of L-dopa in healthy volunteers. Clin Neuropharmacol. 1990 Oct;13(5):436-47. | ||||
Ref 532159 | Pharmacokinetics, pharmacodynamics and tolerability of opicapone, a novel catechol-O-methyltransferase inhibitor, in healthy subjects: prediction of slow enzyme-inhibitor complex dissociation of a short-living and very long-acting inhibitor. Clin Pharmacokinet. 2013 Feb;52(2):139-51. | ||||
Ref 534927 | Tolcapone: a novel approach to Parkinson's disease. Am J Health Syst Pharm. 1999 Nov 1;56(21):2195-205. | ||||
Ref 535173 | Catechol-O-methyltransferase inhibitors in the management of Parkinson's disease. Semin Neurol. 2001;21(1):15-22. | ||||
Ref 535204 | Entacapone: a catechol-O-methyltransferase inhibitor for the adjunctive treatment of Parkinson's disease. Clin Ther. 2001 Jun;23(6):802-32; discussion 771. | ||||
Ref 535563 | Chemical synthesis and characterization of conjugates of a novel catechol-O-methyltransferase inhibitor. Bioconjug Chem. 2002 Sep-Oct;13(5):1112-8. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.