Resistance mutation info of drug
Drug General Information | |||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|
Drug ID | D05HFY | ||||||||||
Drug Name | Acenocoumarol | ||||||||||
Synonyms | Acenocoumarin; Acenocoumarolum; Acenocumarol; Acenocumarolo; Acenocumarolum; Acenokumarin; Ascumar; Minisintrom; Neositron;Nicoumalone; Nicumalon; Nitrovarfarian; Nitrowarfarin; Sincoumar; Sinkumar; Sinthrom; Sinthrome; Sintrom; Sintroma; Syncoumar; Syncumar; Synthrom; Syntrom; Zotil; Acenocoumarol Alliance Brand; Acenocoumarol Novartis Brand; Acenocoumarol [INN]; Acenocumarolo [DCIT]; Acenokumarin [Czech]; Alliance Brand of Acenocoumarol; Ciba Geigy Brand of Acenocoumarol; Mini Sintrom; Novartis Brand of Acenocoumarol; G 23350; Acenocoumarol (INN); Acenocoumarol Ciba-Geigy Brand; Acenocoumarolum [INN-Latin]; Ciba-Geigy Brand of Acenocoumarol; G-23350; Mini-sintrom; Sinthrome (TN); Sintrom (TN); AB-014/25000129; G-23,350; Mini-sintrom (TN); Nitrophenylacetylethyl-4-hydroxycoumarine; 2-hydroxy-3-[1-(4-nitrophenyl)-3-oxobutyl]-4h-chromen-4-one; 2-hydroxy-3-[1-(4-nitrophenyl)-3-oxobutyl]chromen-4-one; 3-(alpha-(4'-Nitrophenyl)-beta-acetylethyl)-4-hydroxycoumarin; 3-(alpha-(p-Nitrophenol)-beta-acetylethyl)-4-hydroxycoumarin; 3-(alpha-Acetonyl-4-nitrobenzyl)-4-hydroxycoumarin; 3-(alpha-Acetonyl-p-nitrobenzyl)-4-hydroxycoumarin; 3-(alpha-Acetonyl-para-nitrobenzyl)-4-hydroxy-coumarin; 3-(alpha-p-Nitrophenyl-beta-acetylethyl)-4-hydroxycoumarin; 4-Hydroxy-3-(1-(4-nitrophenyl)-3-oxobutyl)-2H-1-benzopyran-2-one;4-Hydroxy-3-[1-(4-nitrophenyl)-3-oxobutyl]-2H-chromen-2-one | ||||||||||
Drug Type | Small molecular drug | ||||||||||
Therapeutic Class | Anticoagulants | ||||||||||
Structure |
![]() |
||||||||||
Drug Resistance Mutations | |||||||||||
Target Name | Vitamin K epoxide reductase complex subunit 1 (VKORC1) | Target Info | |||||||||
Gene Name | VKORC1 | ||||||||||
Uniprot ID | VKOR1_HUMAN | ||||||||||
Species | Homo sapiens | ||||||||||
Reference Sequence |
MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRWG RGFGLVEHVLGQDSILNQSNSIFGCIFYTLQLLLGCLRTRWASVLMLLSSLVSLAGSVYL AWILFFVLYDFCIVCITTYAINVSLMWLSFRKVQEPQGKAKRH [Homo sapiens] |
||||||||||
Targeted Disease | Pulmonary embolism | ||||||||||
Drug Resistance Mutations |
|
||||||||||
References | |||||||||||
REF 1 | [Resistance to acenocoumarol revealing a missense mutation of the vitamin K epoxyde reductase VKORC1: a case report].Ann Cardiol Angeiol (Paris).2015 Feb;64(1):59-61. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.