Target Regulator(s) Information (Transcription Factor)
| Target General Information | Top | ||||
|---|---|---|---|---|---|
| Target ID | T68163 | Target Info | |||
| Target Name | Tyrosine-protein kinase Lyn (JTK8) | ||||
| Synonyms | p56Lyn; p53Lyn; V-yes-1 Yamaguchi sarcoma viral related oncogene homolog; Lck/Yes-related novel protein tyrosine kinase | ||||
| Target Type | Clinical trial Target | ||||
| Gene Name | LYN | ||||
| Biochemical Class | Kinase | ||||
| UniProt ID | |||||
| The Transcription Factors (TFs) Regulating This Target | Top | ||||
|---|---|---|---|---|---|
| TF Name | ETS-related transcription factor Elf-1 (ELF1) | ||||
| Classification | Superclass | Helix-turn-helix | |||
| Class | Tryptophan clusters | ||||
| Family | Ets-type | ||||
| Regulation Mechanism | NERF-2 and ELF1, and not NERF-1a and NERF-1b, function as transcriptional activators of the LYN and BLK gene promoters. | [1] | |||
| Evidence Score (E-score) | 1 | + | |||
| 1 | Electrophoretic Mobility Shift Assay, Luciferase Reporter Assay | [1] | |||
| UniProt ID | |||||
| Sequence |
MAAVVQQNDLVFEFASNVMEDERQLGDPAIFPAVIVEHVPGADILNSYAGLACVEEPNDM
ITESSLDVAEEEIIDDDDDDITLTVEASCHDGDETIETIEAAEALLNMDSPGPMLDEKRI NNNIFSSPEDDMVVAPVTHVSVTLDGIPEVMETQQVQEKYADSPGASSPEQPKRKKGRKT KPPRPDSPATTPNISVKKKNKDGKGNTIYLWEFLLALLQDKATCPKYIKWTQREKGIFKL VDSKAVSRLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQFKEMPKDLIYIN DEDPSSSIESSDPSLSSSATSNRNQTSRSRVSSSPGVKGGATTVLKPGNSKAAKPKDPVE VAQPSEVLRTVQPTQSPYPTQLFRTVHVVQPVQAVPEGEAARTSTMQDETLNSSVQSIRT IQAPTQVPVVVSPRNQQLHTVTLQTVPLTTVIASTDPSAGTGSQKFILQAIPSSQPMTVL KENVMLQSQKAGSPPSIVLGPAQVQQVLTSNVQTICNGTVSVASSPSFSATAPVVTFSPR SSQLVAHPPGTVITSVIKTQETKTLTQEVEKKESEDHLKENTEKTEQQPQPYVMVVSSSN GFTSQVAMKQNELLEPNSF |
||||
| The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
| Cytokines / Cytokine receptors | [+] 1 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
| 1 | Interleukin 2 receptor alpha (IL2RA) | Successful Target | Target Info | [2] | |
| Kinases | [+] 1 Kinases Co-regulated By This TF | + | |||
| 1 | Tyrosine-protein kinase Lyn (JTK8) | Clinical trial Target | Target Info | [1] | |
| Oxidoreductases | [+] 1 Oxidoreductases Co-regulated By This TF | + | |||
| 1 | Nitric-oxide synthase endothelial (NOS3) | Clinical trial Target | Target Info | [3] | |
| References | Top | ||||
|---|---|---|---|---|---|
| REF 1 | Characterization of NERF, a novel transcription factor related to the Ets factor ELF-1. Mol Cell Biol. 1996 Sep;16(9):5091-106. | ||||
| REF 2 | Regulation of cell-type-specific interleukin-2 receptor alpha-chain gene expression: potential role of physical interactions between Elf-1, HMG-I(Y... Mol Cell Biol. 1995 Mar;15(3):1786-96. | ||||
| REF 3 | Characterization of the human endothelial nitric-oxide synthase promoter. J Biol Chem. 1999 Jan 29;274(5):3076-93. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.