Target Regulator(s) Information (Transcription Factor)
| Target General Information | Top | ||||
|---|---|---|---|---|---|
| Target ID | T92834 | Target Info | |||
| Target Name | Amphiregulin (AREG) | ||||
| Synonyms | SDGF; Colorectum cellderived growth factor; Colorectum cell-derived growth factor; CRDGF; AREGB; AR | ||||
| Target Type | Literature-reported Target | ||||
| Gene Name | AREG | ||||
| UniProt ID | |||||
| The Transcription Factors (TFs) Regulating This Target | Top | ||||
|---|---|---|---|---|---|
| TF Name | Wilms tumor protein (WT1) homodimer | ||||
| Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
| Class | Cys2His2 zinc finger domain | ||||
| Family | Developmental / cell cycle regulators | ||||
| Subfamily | GLI-like | ||||
| Regulation Type | Increase | ||||
| Regulation Mechanism | TheWT1(-KTS) isoform binds directly to theAREGpromoter, resulting in potent transcriptional activation. | [1] | |||
| Evidence Score (E-score) | 1 | + | |||
| 1 | Luciferase Reporter Assay, Electrophoretic Mobility Shift Assay, DNase I Footprint Analysis | [1] | |||
| UniProt ID | |||||
| Sequence |
MGSDVRDLNALLPAVPSLGGGGGCALPVSGAAQWAPVLDFAPPGASAYGSLGGPAPPPAP
PPPPPPPPHSFIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPFGPPPPSQA SSGQARMFPNAPYLPSCLESQPAIRNQGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHED PMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQ MNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRIHTHGVFRGIQDV RRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDC ERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPS CQKKFARSDELVRHHNMHQRNMTKLQLAL |
||||
| The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
| Apoptosis regulators | [+] 1 Apoptosis regulators Co-regulated By This TF | + | |||
| 1 | Apoptosis regulator Bcl-2 (BCL-2) | Successful Target | Target Info | [2] | |
| Growth factors | [+] 2 Growth factors Co-regulated By This TF | + | |||
| 1 | Amphiregulin (AREG) | Literature-reported Target | Target Info | [1] | |
| 2 | Platelet-derived growth factor A (PDGFA) | Clinical trial Target | Target Info | [3] | |
| Kinases | [+] 2 Kinases Co-regulated By This TF | + | |||
| 1 | Epidermal growth factor receptor (EGFR) | Successful Target | Target Info | [4] | |
| 2 | Telomerase reverse transcriptase (TERT) | Clinical trial Target | Target Info | [5] | |
| Pleiotrophins | [+] 1 Pleiotrophins Co-regulated By This TF | + | |||
| 1 | Midgestation and kidney protein (Midkine) | Literature-reported Target | Target Info | [6] | |
| References | Top | ||||
|---|---|---|---|---|---|
| REF 1 | The Wilms tumor suppressor WT1 encodes a transcriptional activator of amphiregulin. Cell. 1999 Sep 3;98(5):663-73. | ||||
| REF 2 | WT1 modulates apoptosis by transcriptionally upregulating the bcl-2 proto-oncogene. EMBO J. 1999 Jul 15;18(14):3990-4003. | ||||
| REF 3 | The Wilms' tumor gene product, WT1, represses transcription of the platelet-derived growth factor A-chain gene. J Biol Chem. 1992 Nov 5;267(31):21999-2002. | ||||
| REF 4 | WT1 suppresses synthesis of the epidermal growth factor receptor and induces apoptosis. EMBO J. 1995 Oct 2;14(19):4662-75. | ||||
| REF 5 | The Wilms' tumor 1 tumor suppressor gene represses transcription of the human telomerase reverse transcriptase gene. J Biol Chem. 1999 Dec 24;274(52):37473-8. | ||||
| REF 6 | Midkine as a novel target gene for the Wilms' tumor suppressor gene (WT1). Oncogene. 1996 Nov 21;13(10):2197-203. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.