Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T02808
(Former ID: TTDI01922)
|
|||||
| Target Name |
Interferon-beta (IFNB1)
|
|||||
| Synonyms |
Interferon beta; IFNbeta; IFNB; IFN-beta; IFB; Fibroblast interferon
Click to Show/Hide
|
|||||
| Gene Name |
IFNB1
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 2 Target-related Diseases | + | ||||
| 1 | Multiple sclerosis [ICD-11: 8A40] | |||||
| 2 | Type 2 diabetes mellitus [ICD-11: 5A11] | |||||
| Function |
Has antiviral, antibacterial and anticancer activities.
Click to Show/Hide
|
|||||
| BioChemical Class |
Cytokine: interferon
|
|||||
| UniProt ID | ||||||
| Sequence |
MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFD
IPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLK TVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINR LTGYLRN Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
| HIT2.0 ID | T10I26 | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 2 Approved Drugs | + | ||||
| 1 | PEGylated IFN beta 1-a | Drug Info | Approved | Type-2 diabetes | [1], [4] | |
| 2 | PLEGRIDY | Drug Info | Approved | Multiple sclerosis | [5], [6] | |
| Clinical Trial Drug(s) | [+] 7 Clinical Trial Drugs | + | ||||
| 1 | Biferonex | Drug Info | Phase 3 | Multiple sclerosis | [7] | |
| 2 | FP-1201 | Drug Info | Phase 3 | Acute lung injury | [8] | |
| 3 | NU-100 | Drug Info | Phase 3 | Multiple sclerosis | [9] | |
| 4 | AZ-01, PEGylated interferon-beta | Drug Info | Phase 2 | Multiple sclerosis | [11] | |
| 5 | PF-06823859 | Drug Info | Phase 2 | Rheumatoid arthritis | [12] | |
| 6 | ARX-424 | Drug Info | Phase 1 | Multiple sclerosis | [13] | |
| 7 | Gene therapy, IFN-b | Drug Info | Phase 1 | Glioblastoma multiforme | [14] | |
| Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
| 1 | TV-1390 | Drug Info | Preclinical | Multiple sclerosis | [15] | |
| Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
| 1 | Maxy-10 | Drug Info | Terminated | Autoimmune diabetes | [16] | |
| Mode of Action | [+] 2 Modes of Action | + | ||||
| Modulator | [+] 10 Modulator drugs | + | ||||
| 1 | PEGylated IFN beta 1-a | Drug Info | [1] | |||
| 2 | PLEGRIDY | Drug Info | [6] | |||
| 3 | Biferonex | Drug Info | [7] | |||
| 4 | FP-1201 | Drug Info | [17] | |||
| 5 | NU-100 | Drug Info | [18] | |||
| 6 | AZ-01, PEGylated interferon-beta | Drug Info | [18] | |||
| 7 | ARX-424 | Drug Info | [18] | |||
| 8 | Gene therapy, IFN-b | Drug Info | [19] | |||
| 9 | TV-1390 | Drug Info | [20] | |||
| 10 | Maxy-10 | Drug Info | [21] | |||
| Blocker | [+] 1 Blocker drugs | + | ||||
| 1 | PF-06823859 | Drug Info | [12] | |||
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Biological Network Descriptors
of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.
The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information
(Front Pharmacol, 9, 1245, 2018;
Curr Opin Struct Biol. 44:134-142, 2017).
Human Similarity Proteins
Human Pathway Affiliation
Biological Network Descriptors
|
|
|
There is no similarity protein (E value < 0.005) for this target
|
| KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
|---|---|---|---|
| Cytokine-cytokine receptor interaction | hsa04060 | Affiliated Target |
|
| Class: Environmental Information Processing => Signaling molecules and interaction | Pathway Hierarchy | ||
| PI3K-Akt signaling pathway | hsa04151 | Affiliated Target |
|
| Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
| Necroptosis | hsa04217 | Affiliated Target |
|
| Class: Cellular Processes => Cell growth and death | Pathway Hierarchy | ||
| Osteoclast differentiation | hsa04380 | Affiliated Target |
|
| Class: Organismal Systems => Development and regeneration | Pathway Hierarchy | ||
| Toll-like receptor signaling pathway | hsa04620 | Affiliated Target |
|
| Class: Organismal Systems => Immune system | Pathway Hierarchy | ||
| NOD-like receptor signaling pathway | hsa04621 | Affiliated Target |
|
| Class: Organismal Systems => Immune system | Pathway Hierarchy | ||
| RIG-I-like receptor signaling pathway | hsa04622 | Affiliated Target |
|
| Class: Organismal Systems => Immune system | Pathway Hierarchy | ||
| Cytosolic DNA-sensing pathway | hsa04623 | Affiliated Target |
|
| Class: Organismal Systems => Immune system | Pathway Hierarchy | ||
| JAK-STAT signaling pathway | hsa04630 | Affiliated Target |
|
| Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
| Natural killer cell mediated cytotoxicity | hsa04650 | Affiliated Target |
|
| Class: Organismal Systems => Immune system | Pathway Hierarchy | ||
| TNF signaling pathway | hsa04668 | Affiliated Target |
|
| Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
| Click to Show/Hide the Information of Affiliated Human Pathways | |||
| Degree | 18 | Degree centrality | 1.93E-03 | Betweenness centrality | 1.26E-04 |
|---|---|---|---|---|---|
| Closeness centrality | 2.34E-01 | Radiality | 1.41E+01 | Clustering coefficient | 3.27E-01 |
| Neighborhood connectivity | 3.88E+01 | Topological coefficient | 1.15E-01 | Eccentricity | 11 |
| Download | Click to Download the Full PPI Network of This Target | ||||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target-regulating Transcription Factors | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Pegylated interferon beta-1a for relapsing-remitting multiple sclerosis (ADVANCE): a randomised, phase 3, double-blind study. Lancet Neurol. 2014 Jul;13(7):657-65. | |||||
| REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8339). | |||||
| REF 3 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. | |||||
| REF 4 | ClinicalTrials.gov (NCT02234869) Transition to Peginterferon Beta-1a (BIIB017) From Subcutaneous Interferon Therapy. U.S. National Institutes of Health. | |||||
| REF 5 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7637). | |||||
| REF 6 | 2014 FDA drug approvals. Nat Rev Drug Discov. 2015 Feb;14(2):77-81. | |||||
| REF 7 | Improving compliance with interferon-beta therapy in patients with multiple sclerosis. CNS Drugs. 2009;23(6):453-62. | |||||
| REF 8 | Clinical pipeline report, company report or official report of Faron Pharmaceuticals. | |||||
| REF 9 | ClinicalTrials.gov (NCT01464905) Phase 3 Study to Evaluate Efficacy and Safety of NU100 in Patients With Relapsing Remitting Multiple Sclerosis (RRMS). U.S. National Institutes of Health. | |||||
| REF 10 | Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41. | |||||
| REF 11 | Clinical pipeline report, company report or official report of Allozyne Inc. | |||||
| REF 12 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 13 | Clinical pipeline report, company report or official report of Merck Serono. | |||||
| REF 14 | A phase I clinical trial of interferon-beta gene therapy for high-grade glioma: novel findings from gene expression profiling and autopsy. J Gene Med. 2008 Apr;10(4):329-39. | |||||
| REF 15 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032947) | |||||
| REF 16 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016147) | |||||
| REF 17 | The effect of intravenous interferon-beta-1a (FP-1201) on lung CD73 expression and on acute respiratory distress syndrome mortality: an open-label study.Lancet Respir Med. 2014 Feb;2(2):98-107. | |||||
| REF 18 | PEGylated interferon beta-1a in the treatment of multiple sclerosis - an update. Biologics. 2013; 7: 131-138. | |||||
| REF 19 | Interferon-beta gene therapy for cancer: basic research to clinical application. Cancer Sci. 2004 Nov;95(11):858-65. | |||||
| REF 20 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032947) | |||||
| REF 21 | US patent application no. 8,669,257, Phenazine derivatives and uses thereof as potassium channel modulators. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.