Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T09058
(Former ID: TTDR00714)
|
|||||
Target Name |
Oncotrophoblast glycoprotein 5T4 (TPBG)
|
|||||
Synonyms |
Trophoblast glycoprotein; TPBG
Click to Show/Hide
|
|||||
Gene Name |
TPBG
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 2 Target-related Diseases | + | ||||
1 | Prostate cancer [ICD-11: 2C82] | |||||
2 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
Function |
May function as an inhibitor of Wnt/beta-catenin signaling by indirectly interacting with LRP6 and blocking Wnt3a- dependent LRP6 internalization.
Click to Show/Hide
|
|||||
UniProt ID | ||||||
Sequence |
MPGGCSRGPAAGDGRLRLARLALVLLGWVSSSSPTSSASSFSSSAPFLASAVSAQPPLPD
QCPALCECSEAARTVKCVNRNLTEVPTDLPAYVRNLFLTGNQLAVLPAGAFARRPPLAEL AALNLSGSRLDEVRAGAFEHLPSLRQLDLSHNPLADLSPFAFSGSNASVSAPSPLVELIL NHIVPPEDERQNRSFEGMVVAALLAGRALQGLRRLELASNHFLYLPRDVLAQLPSLRHLD LSNNSLVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLAELQGLPHIRVFLDNNPWVCDC HMADMVTWLKETEVVQGKDRLTCAYPEKMRNRVLLELNSADLDCDPILPPSLQTSYVFLG IVLALIGAIFLLVLYLNRKGIKKWMHNIRDACRDHMEGYHYRYEINADPRLTNLSSNSDV Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 4 Clinical Trial Drugs | + | ||||
1 | TroVax | Drug Info | Phase 3 | Prostate cancer | [2] | |
2 | Naptumomab estafenatox | Drug Info | Phase 2/3 | Solid tumour/cancer | [3] | |
3 | CV-9201 | Drug Info | Phase 1/2 | Non-small-cell lung cancer | [4] | |
4 | PF-06263507 | Drug Info | Phase 1 | Solid tumour/cancer | [6] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Immunomodulator | [+] 1 Immunomodulator drugs | + | ||||
1 | Naptumomab estafenatox | Drug Info | [9] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Tissue Distribution
of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues.
The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects
(Nat Rev Drug Discov, 20: 64-81, 2021).
Human Similarity Proteins
Human Tissue Distribution
|
Protein Name | Pfam ID | Percentage of Identity (%) | E value |
---|---|---|---|
Leucine-rich repeat and fibronectin type-III domain-containing protein 5 (LRFN5) | 35.385 (23/65) | 2.00E-03 |
Note:
If a protein has TS (tissue specficity) scores at least in one tissue >= 2.5, this protein is called tissue-enriched (including tissue-enriched-but-not-specific and tissue-specific). In the plots, the vertical lines are at thresholds 2.5 and 4.
|
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Vaccination of metastatic renal cancer patients with MVA-5T4: a randomized, double-blind, placebo-controlled phase III study. Clin Cancer Res. 2010 Nov 15;16(22):5539-47. | |||||
REF 2 | ClinicalTrials.gov (NCT00397345) TroVax Renal Immunotherapy Survival Trial. U.S. National Institutes of Health. | |||||
REF 3 | ClinicalTrials.gov (NCT00420888) ABR-217620/Naptumomab Estafenatox With Interferon-alpha (IFN-alpha) Compared to IFN-alpha Alone in Patients With Advanced Renal Cell Carcinoma. U.S. National Institutes of Health. | |||||
REF 4 | ClinicalTrials.gov (NCT00923312) Trial of an RNActive-Derived Cancer Vaccine in Stage IIIB/IV Non Small Cell Lung Cancer (NSCLC). U.S. National Institutes of Health. | |||||
REF 5 | ClinicalTrials.gov (NCT04424641) A Study on the Safety of GEN1044 (DuoBody-CD3x5T4) in Subjects With Malignant Solid Tumors. U.S. National Institutes of Health. | |||||
REF 6 | ClinicalTrials.gov (NCT01891669) A Study Of PF-06263507 In Patients With Advanced Solid Tumors. U.S. National Institutes of Health. | |||||
REF 7 | Clinical pipeline report, company report or official report of Purple | |||||
REF 8 | A phase II study of a 5T4 oncofoetal antigen tumour-targeted superantigen (ABR-214936) therapy in patients with advanced renal cell carcinoma. Br J Cancer. 2007 Feb 26;96(4):567-74. | |||||
REF 9 | Naptumomab estafenatox: targeted immunotherapy with a novel immunotoxin. Curr Oncol Rep. 2014 Feb;16(2):370. | |||||
REF 10 | National Cancer Institute Drug Dictionary (drug id 648549). | |||||
REF 11 | National Cancer Institute Drug Dictionary (drug id 751006). |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.