Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T13201
(Former ID: TTDR01224)
|
|||||
| Target Name |
Carbonic anhydrase I (CA-I)
|
|||||
| Synonyms |
Carbonic anhydrase B; Carbonic anhydrase 1; Carbonate dehydratase I; CAB
Click to Show/Hide
|
|||||
| Gene Name |
CA1
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 2 Target-related Diseases | + | ||||
| 1 | Glaucoma [ICD-11: 9C61] | |||||
| 2 | Seborrhoeic dermatitis [ICD-11: EA81] | |||||
| Function |
Can hydrates cyanamide to urea. Reversible hydration of carbon dioxide.
Click to Show/Hide
|
|||||
| BioChemical Class |
Alpha-carbonic anhydrase
|
|||||
| UniProt ID | ||||||
| EC Number |
EC 4.2.1.1
|
|||||
| Sequence |
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH VAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNF DPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAV PMQHNNRPTQPLKGRTVRASF Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
| HIT2.0 ID | T63Y3C | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 5 Approved Drugs | + | ||||
| 1 | Acetazolamide | Drug Info | Approved | Glaucoma/ocular hypertension | [2], [3] | |
| 2 | Dichlorphenamide | Drug Info | Approved | Chronic glaucoma | [4], [5] | |
| 3 | Ethoxzolamide | Drug Info | Approved | Glaucoma/ocular hypertension | [6], [7] | |
| 4 | Methazolamide | Drug Info | Approved | Glaucoma/ocular hypertension | [8], [9] | |
| 5 | Salicyclic acid | Drug Info | Approved | Seborrhoeic dermatitis | [10], [11], [12] | |
| Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
| 1 | Curcumin | Drug Info | Phase 3 | Solid tumour/cancer | [15], [16] | |
| Mode of Action | [+] 2 Modes of Action | + | ||||
| Modulator | [+] 5 Modulator drugs | + | ||||
| 1 | Acetazolamide | Drug Info | [18] | |||
| 2 | Dichlorphenamide | Drug Info | [18] | |||
| 3 | Ethoxzolamide | Drug Info | [18] | |||
| 4 | Methazolamide | Drug Info | [1] | |||
| 5 | L-693612 | Drug Info | [57], [58] | |||
| Inhibitor | [+] 161 Inhibitor drugs | + | ||||
| 1 | Salicyclic acid | Drug Info | [19] | |||
| 2 | Curcumin | Drug Info | [20] | |||
| 3 | PARABEN | Drug Info | [21] | |||
| 4 | PHENOL | Drug Info | [20] | |||
| 5 | FERULIC ACID | Drug Info | [21] | |||
| 6 | (2-bromophenyl)difluoromethanesulfonamide | Drug Info | [22] | |||
| 7 | (4-bromophenyl)difluoromethanesulfonamide | Drug Info | [22] | |||
| 8 | 1,4-Dihydro-1-methyl-4-oxo-3-pyridinesulfonamide | Drug Info | [23] | |||
| 9 | 1-acetamido-5-sulfonamidoindane | Drug Info | [24] | |||
| 10 | 1-Benzyl-1,4-dihydro-4-oxo-3-pyridinesulfonamide | Drug Info | [23] | |||
| 11 | 1-cyclohexylamido-5-sulfonamidoindane | Drug Info | [25] | |||
| 12 | 1-pentafluorophenylamido-5-sulfonamidoindane | Drug Info | [25] | |||
| 13 | 1-valproylamido-5-sulfonamidoindane | Drug Info | [25] | |||
| 14 | 2,2,2-Trifluoro-N-(4-sulfamoyl-phenyl)-acetamide | Drug Info | [26] | |||
| 15 | 2,3-dihydro-1H-indene-5-sulfonamide | Drug Info | [24] | |||
| 16 | 2,4-dichloro-5-sulfamoylbenzoic acid | Drug Info | [27] | |||
| 17 | 2,4-Disulfamyltrifluoromethylaniline | Drug Info | [28] | |||
| 18 | 2-(4-chlorobenzyloxyamino)-N-hydroxyacetamide | Drug Info | [29] | |||
| 19 | 2-(4-chlorobenzyloxyamino)-N-hydroxyhexanamide | Drug Info | [29] | |||
| 20 | 2-(4-chlorobenzyloxyamino)-N-hydroxypropanamide | Drug Info | [29] | |||
| 21 | 2-(biphenyl-4-yl)vinylboronic acid | Drug Info | [30] | |||
| 22 | 2-acetamido-5-sulfonamidoindane | Drug Info | [25] | |||
| 23 | 2-Acetylamino-indan-5-sulfonic acid hydrate | Drug Info | [24] | |||
| 24 | 2-Amino-indan-5-sulfonic acid | Drug Info | [24] | |||
| 25 | 2-butylamido-5-sulfonamidoindane | Drug Info | [25] | |||
| 26 | 2-cyclohexylamido-5-sulfonamidoindane | Drug Info | [25] | |||
| 27 | 2-ethylamido-5-sulfonamidoindane | Drug Info | [25] | |||
| 28 | 2-Hydroxycinnamic acid | Drug Info | [20] | |||
| 29 | 2-Mercapto-N-(4-sulfamoyl-phenyl)-benzamide | Drug Info | [31] | |||
| 30 | 2-Morpholin-4-yl-N-(4-sulfamoyl-phenyl)-acetamide | Drug Info | [32] | |||
| 31 | 2-nonylamido-5-sulfonamidoindane | Drug Info | [25] | |||
| 32 | 2-oxo-2H-chromene-3-carboxylic acid | Drug Info | [33] | |||
| 33 | 2-oxo-2H-thiochromene-3-carboxylic acid | Drug Info | [33] | |||
| 34 | 2-pentafluorophenylamido-5-sulfonamidoindane | Drug Info | [25] | |||
| 35 | 2-propylamido-5-sulfonamidoindane | Drug Info | [25] | |||
| 36 | 2-valproylamido-5-sulfonamidoindane | Drug Info | [25] | |||
| 37 | 3-(3-Phenyl-ureido)-benzenesulfonamide | Drug Info | [26] | |||
| 38 | 3-(4-sulfamoylphenyl)propanoic acid | Drug Info | [28], [34] | |||
| 39 | 3-bromophenyl-difluoromethanesulfonamide | Drug Info | [22] | |||
| 40 | 3-Chloro-4-hydrazino-benzenesulfonamide | Drug Info | [35] | |||
| 41 | 3-Fluoro-4-hydrazino-benzenesulfonamide | Drug Info | [35] | |||
| 42 | 3-mercapto-N-(4-sulfamoyl-phenyl)-propionamide | Drug Info | [36] | |||
| 43 | 3-phenyl-5-sulfamoyl-1H-indole-2-carboxamide | Drug Info | [37] | |||
| 44 | 3-phenylprop-1-enylboronic acid | Drug Info | [30] | |||
| 45 | 4,4'-thiodipyridine-3-sulfonamide | Drug Info | [38] | |||
| 46 | 4,6-Dinitro salicylic acid | Drug Info | [39] | |||
| 47 | 4-(2-AMINOETHYL)BENZENESULFONAMIDE | Drug Info | [40] | |||
| 48 | 4-(2-aminopyrimidin-4-ylamino)benzenesulfonamide | Drug Info | [28] | |||
| 49 | 4-(2-Methyl-8-quinolinoxy)-3-pyridinesulfonamide | Drug Info | [38] | |||
| 50 | 4-(2-Phenylacetamido)-3-chlorobenzenesulfonamide | Drug Info | [41] | |||
| 51 | 4-(2-Phenylacetamido)-3-fluorobenzenesulfonamide | Drug Info | [41] | |||
| 52 | 4-(2-Phenylacetamido)benzenesulfonamide | Drug Info | [41] | |||
| 53 | 4-(2-Phenylacetamidoethyl)benzenesulfonamide | Drug Info | [41] | |||
| 54 | 4-(2-Phenylacetamidomethyl)benzenesulfonamide | Drug Info | [41] | |||
| 55 | 4-(2-Propynylthio)pyridine-3-sulfonamide | Drug Info | [38] | |||
| 56 | 4-(2-Pyridin-2-ylacetamido)benzenesulfonamide | Drug Info | [41] | |||
| 57 | 4-(2-Pyridin-4-ylacetamido)benzenesulfonamide | Drug Info | [41] | |||
| 58 | 4-(4-Cyanophenoxy)-3-pyridinesulfonamide | Drug Info | [38] | |||
| 59 | 4-(4-Fluorophenoxy)-3-pyridinesulfonamide | Drug Info | [38] | |||
| 60 | 4-(5-Methyl-2-pirazolino)-3-pyridinesulfonamide | Drug Info | [38] | |||
| 61 | 4-(Allylamino)-3-pyridinesulfonamide | Drug Info | [38] | |||
| 62 | 4-(Cyanomethylthio)pyridine-3-sulfonamide | Drug Info | [38] | |||
| 63 | 4-(hydroxymethyl)benzenesulfonamide | Drug Info | [28] | |||
| 64 | 4-(Methylhydrazino)-3-pyridinesulfonamide | Drug Info | [38] | |||
| 65 | 4-(N-Oxide-2-pyridylthio)pyridine-3-sulfonamide | Drug Info | [38] | |||
| 66 | 4-(Quinolinoxy)-3-pyridinesulfonamide | Drug Info | [38] | |||
| 67 | 4-Amino-3-bromo-benzenesulfonamide | Drug Info | [28] | |||
| 68 | 4-Amino-3-fluoro-benzenesulfonamide | Drug Info | [42] | |||
| 69 | 4-Amino-3-iodo-benzenesulfonamide | Drug Info | [28] | |||
| 70 | 4-Benzythiopyridine-3-sulfonamide | Drug Info | [38] | |||
| 71 | 4-butylphenylboronic acid | Drug Info | [30] | |||
| 72 | 4-Chloro-N-(5-sulfamoyl-indan-2-yl)-benzamide | Drug Info | [24] | |||
| 73 | 4-Ethoxy-3-pyridinesulfonamide | Drug Info | [38] | |||
| 74 | 4-ethynyl benzene sulfonamide | Drug Info | [43] | |||
| 75 | 4-Hydrazino-benzenesulfonamide | Drug Info | [35] | |||
| 76 | 4-Hydrazinocarbonyl-benzenesulfonamide | Drug Info | [35] | |||
| 77 | 4-isothiocyanatobenzenesulfonamide | Drug Info | [44] | |||
| 78 | 4-Methanesulfonylamino-benzenesulfonamide | Drug Info | [26] | |||
| 79 | 4-Methoxy-3-pyridinesulfonamide | Drug Info | [38] | |||
| 80 | 4-methoxyphenylboronic acid | Drug Info | [30] | |||
| 81 | 4-methylphenyl-difluoromethanesulfonamide | Drug Info | [22] | |||
| 82 | 4-Methylthiopyridine-3-sulfonamide | Drug Info | [38] | |||
| 83 | 4-nitrophenyl phosphate | Drug Info | [45] | |||
| 84 | 4-nitrophenyl-difluoromethanesulfonamide | Drug Info | [22] | |||
| 85 | 4-phenoxyphenylboronic acid | Drug Info | [30] | |||
| 86 | 4-[2-(2-Thienyl)acetamidoethyl]benzenesulfonamide | Drug Info | [41] | |||
| 87 | 4-[2-(3-Phenyl-ureido)-ethyl]-benzenesulfonamide | Drug Info | [26] | |||
| 88 | 5-Chlorosalicylic Acid | Drug Info | [39] | |||
| 89 | 5-hydroxy-1-tosyl-1H-pyrrol-2(5H)-one | Drug Info | [46] | |||
| 90 | 5-oxo-1-tosyl-2,5-dihydro-1Hpyrrol-2-yl acetate | Drug Info | [46] | |||
| 91 | 6-(aminomethyl)-2H-chromen-2-one | Drug Info | [33] | |||
| 92 | 6-Amino-benzothiazole-2-sulfonic acid amide | Drug Info | [47] | |||
| 93 | 6-Hydroxy-benzothiazole-2-sulfonic acid amide | Drug Info | [48] | |||
| 94 | 6-methoxy-2-oxo-2H-chromene-3-carboxylic acid | Drug Info | [33] | |||
| 95 | 6-methyl-2-oxo-2H-chromene-3-carboxylic acid | Drug Info | [33] | |||
| 96 | 7-methoxy-2-oxo-2H-chromene-4-carboxylic acid | Drug Info | [33] | |||
| 97 | 8-methoxy-2-oxo-2H-chromene-3-carboxylic acid | Drug Info | [33] | |||
| 98 | Aminobenzolamide derivative | Drug Info | [49] | |||
| 99 | Azide | Drug Info | [50] | |||
| 100 | BENZENESULFONAMIDE | Drug Info | [51] | |||
| 101 | BENZOLAMIDE | Drug Info | [28] | |||
| 102 | Beta-naphthylboronic acid | Drug Info | [30] | |||
| 103 | Biphenyl-4-ylboronic acid | Drug Info | [30] | |||
| 104 | Carzenide | Drug Info | [51] | |||
| 105 | COUMARIN | Drug Info | [52] | |||
| 106 | CYANATE | Drug Info | [50] | |||
| 107 | Cynooxide anion | Drug Info | [53] | |||
| 108 | Decane-1,10-diyl disulfamate | Drug Info | [54] | |||
| 109 | Decyl sulfamate | Drug Info | [54] | |||
| 110 | ELLAGIC ACID | Drug Info | [21] | |||
| 111 | ETHYL 3-[4-(AMINOSULFONYL)PHENYL]PROPANOATE | Drug Info | [34] | |||
| 112 | Hexane-1,6-diamine | Drug Info | [55] | |||
| 113 | HYDROSULFIDE | Drug Info | [50] | |||
| 114 | IODIDE | Drug Info | [56] | |||
| 115 | N-(4-cyanophenyl)sulfamide | Drug Info | [59] | |||
| 116 | N-(4-Sulfamoyl-phenyl)-benzamide | Drug Info | [26] | |||
| 117 | N-(4-Sulfamoyl-phenyl)-butyramide | Drug Info | [26] | |||
| 118 | N-(4-Sulfamoyl-phenyl)-propionamide | Drug Info | [26] | |||
| 119 | N-(4-sulfamoylphenylethyl)-4-sulfamoylbenzamide | Drug Info | [60] | |||
| 120 | N-(5-ethyl-1,3,4-thiadiazol-2-yl)sulfamide | Drug Info | [61] | |||
| 121 | N-(5-Mercapto-[1,3,4]thiadiazol-2-yl)-acetamide | Drug Info | [62] | |||
| 122 | N-(5-phenyl-1,3,4-thiadiazol-2-yl)sulfamide | Drug Info | [61] | |||
| 123 | N-(5-tert-butyl-1,3,4-thiadiazol-2-yl)sulfamide | Drug Info | [61] | |||
| 124 | N-(pentafluorophenyl)sulfamide | Drug Info | [59] | |||
| 125 | N-1,3,4-thiadiazol-2-ylsulfamide | Drug Info | [61] | |||
| 126 | N-hydroxysulfamide | Drug Info | [63] | |||
| 127 | N-hydroxysulfonamides | Drug Info | [64] | |||
| 128 | N-propynyl amidebenzenesulphonide | Drug Info | [65] | |||
| 129 | N-[4-(trifluoromethyl)phenyl]sulfamide | Drug Info | [59] | |||
| 130 | N-[5-(ethylthio)-1,3,4-thiadiazol-2-yl]sulfamide | Drug Info | [61] | |||
| 131 | N-[5-(methylthio)-1,3,4-thiadiazol-2-yl]sulfamide | Drug Info | [61] | |||
| 132 | N-{2-[4-(AMINOSULFONYL)PHENYL]ETHYL}ACETAMIDE | Drug Info | [34] | |||
| 133 | NITRATE | Drug Info | [56] | |||
| 134 | NSC-654077 | Drug Info | [31] | |||
| 135 | Octane-1,8-diyl disulfamate | Drug Info | [54] | |||
| 136 | Octyl sulfamate | Drug Info | [54] | |||
| 137 | P-Coumaric Acid | Drug Info | [21] | |||
| 138 | PARAOXON | Drug Info | [45] | |||
| 139 | Pentane-1,5-diamine | Drug Info | [55] | |||
| 140 | Pentanoic acid (4-sulfamoyl-phenyl)-amide | Drug Info | [26] | |||
| 141 | Phenethylboronic acid | Drug Info | [30] | |||
| 142 | Phenoxyarsonous acid | Drug Info | [56] | |||
| 143 | Phenyl Boronic acid | Drug Info | [56] | |||
| 144 | PHENYLMETHANESULFONAMIDE | Drug Info | [22] | |||
| 145 | PHENYLSULFAMATE | Drug Info | [22] | |||
| 146 | Prop-2-ynyl 4-sulfamoylbenzoate | Drug Info | [65] | |||
| 147 | SACCHARIN | Drug Info | [42] | |||
| 148 | Sodium trithiocarbonate | Drug Info | [66] | |||
| 149 | Styrylboronic acid | Drug Info | [30] | |||
| 150 | SULFAMATE | Drug Info | [56] | |||
| 151 | Sulfamic acid 12-sulfamoyloxy-dodecyl ester | Drug Info | [67] | |||
| 152 | Sulfamic acid 16-sulfamoyloxy-hexadecyl ester | Drug Info | [67] | |||
| 153 | Sulfamic acid 3-sulfamoyloxy-phenyl ester | Drug Info | [67] | |||
| 154 | Sulfamic acid 4-sulfamoyloxy-butyl ester | Drug Info | [67] | |||
| 155 | Sulfamic acid 7-sulfamoyloxy-heptyl ester | Drug Info | [67] | |||
| 156 | SULFATE | Drug Info | [56] | |||
| 157 | Syringic Acid | Drug Info | [21] | |||
| 158 | Thioureido sulfonamide | Drug Info | [68] | |||
| 159 | Trecadrine | Drug Info | [69] | |||
| 160 | [Au(CN)2]- | Drug Info | [70] | |||
| 161 | [Cu(CN)2]- | Drug Info | [70] | |||
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Drug Binding Sites of Target | Top | |||||
|---|---|---|---|---|---|---|
| Ligand Name: Famotidine | Ligand Info | |||||
| Structure Description | Crystal structure of human carbonic anhydrase I in complex with the inhibitor famotidine | PDB:6G3V | ||||
| Method | X-ray diffraction | Resolution | 1.69 Å | Mutation | No | [71] |
| PDB Sequence |
WGYDDKNGPE
14 QWSKLYPIAN24 GNNQSPVDIK34 TSETKHDTSL44 KPISVSYNPA54 TAKEIINVGH 64 SFHVNFEDND74 NRSVLKGGPF84 SDSYRLFQFH94 FHWGSTNEHG104 SEHTVDGVKY 114 SAELHVAHWN124 SAKYSSLAEA134 ASKADGLAVI144 GVLMKVGEAN154 PKLQKVLDAL 164 QAIKTKGKRA174 PFTNFDPSTL184 LPSSLDFWTY194 PGSLTHPPLY204 ESVTWIICKE 214 SISVSSEQLA224 QFRSLLSNVE234 GDNAVPMQHN244 NRPTQPLKGR254 TVRASF |
|||||
|
|
||||||
| Ligand Name: Topiramate | Ligand Info | |||||
| Structure Description | Human Carbonic Anhydrase I in complex with topiramate | PDB:3LXE | ||||
| Method | X-ray diffraction | Resolution | 1.90 Å | Mutation | No | [72] |
| PDB Sequence |
WGYDDKNGPE
14 QWSKLYPIAN24 GNNQSPVDIK34 TSETKHDTSL44 KPISVSYNPA54 TAKEIINVGH 64 SFHVNFEDND74 NRSVLKGGPF84 SDSYRLFQFH94 FHWGSTNEHG104 SEHTVDGVKY 114 SAELHVAHWN124 SAKYSSLAEA134 ASKADGLAVI144 GVLMKVGEAN154 PKLQKVLDAL 164 QAIKTKGKRA174 PFTNFDPSTL184 LPSSLDFWTY194 PGSLTHPPLY204 ESVTWIICKE 214 SISVSSEQLA224 QFRSLLSNVE234 GDNAVPMQHN244 NRPTQPLKGR254 TVRASF |
|||||
|
|
||||||
| Click to View More Binding Site Information of This Target with Different Ligands | ||||||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Tissue Distribution
of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues.
The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects
(Nat Rev Drug Discov, 20: 64-81, 2021).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Human Similarity Proteins
Human Tissue Distribution
Human Pathway Affiliation
|
|
|
There is no similarity protein (E value < 0.005) for this target
|
|
Note:
If a protein has TS (tissue specficity) scores at least in one tissue >= 2.5, this protein is called tissue-enriched (including tissue-enriched-but-not-specific and tissue-specific). In the plots, the vertical lines are at thresholds 2.5 and 4.
|
| KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
|---|---|---|---|
| Nitrogen metabolism | hsa00910 | Affiliated Target |
|
| Class: Metabolism => Energy metabolism | Pathway Hierarchy | ||
| Chemical Structure based Activity Landscape of Target | Top |
|---|---|
| Drug Property Profile of Target | Top | |
|---|---|---|
| (1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
|
||
| (3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
|
||
| (5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
|
||
| "RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five | ||
| Co-Targets | Top | |||||
|---|---|---|---|---|---|---|
| Co-Targets | ||||||
| Target Poor or Non Binders | Top | |||||
|---|---|---|---|---|---|---|
| Target Poor or Non Binders | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 1 KEGG Pathways | + | ||||
| 1 | Nitrogen metabolism | |||||
| Pathwhiz Pathway | [+] 1 Pathwhiz Pathways | + | ||||
| 1 | Gastric Acid Production | |||||
| PID Pathway | [+] 1 PID Pathways | + | ||||
| 1 | C-MYB transcription factor network | |||||
| Reactome | [+] 3 Reactome Pathways | + | ||||
| 1 | Erythrocytes take up carbon dioxide and release oxygen | |||||
| 2 | Erythrocytes take up oxygen and release carbon dioxide | |||||
| 3 | Reversible hydration of carbon dioxide | |||||
| WikiPathways | [+] 3 WikiPathways | + | ||||
| 1 | Reversible Hydration of Carbon Dioxide | |||||
| 2 | Uptake of Carbon Dioxide and Release of Oxygen by Erythrocytes | |||||
| 3 | Uptake of Oxygen and Release of Carbon Dioxide by Erythrocytes | |||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| Target QSAR Model | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2597). | |||||
| REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6792). | |||||
| REF 3 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 040195. | |||||
| REF 4 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6807). | |||||
| REF 5 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 011366. | |||||
| REF 6 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6814). | |||||
| REF 7 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 011047. | |||||
| REF 8 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6828). | |||||
| REF 9 | ClinicalTrials.gov (NCT02463357) Three New Ideas to Protect Special Forces From the Stress of High Altitude. | |||||
| REF 10 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4306). | |||||
| REF 11 | Drug information of Salicyclic acid, 2008. eduDrugs. | |||||
| REF 12 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
| REF 13 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8316). | |||||
| REF 14 | ClinicalTrials.gov (NCT01765296) Phase III Study of CG100649 in Osteoarthritis Patients. U.S. National Institutes of Health. | |||||
| REF 15 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7000). | |||||
| REF 16 | Nanocurcumin: a promising therapeutic advancement over native curcumin. Crit Rev Ther Drug Carrier Syst. 2013;30(4):331-68. | |||||
| REF 17 | Irosustat: a first-generation steroid sulfatase inhibitor in breast cancer. Expert Rev Anticancer Ther. 2011 Feb;11(2):179-83. | |||||
| REF 18 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | |||||
| REF 19 | Carbonic anhydrase inhibitors: inhibition of mammalian isoforms I-XIV with a series of substituted phenols including paracetamol and salicylic acid. Bioorg Med Chem. 2008 Aug 1;16(15):7424-8. | |||||
| REF 20 | Carbonic anhydrase inhibitors. Antioxidant polyphenols effectively inhibit mammalian isoforms I-XV. Bioorg Med Chem Lett. 2010 Sep 1;20(17):5050-3. | |||||
| REF 21 | Carbonic anhydrase inhibitors. Inhibition of mammalian isoforms I-XIV with a series of natural product polyphenols and phenolic acids. Bioorg Med Chem. 2010 Mar 15;18(6):2159-2164. | |||||
| REF 22 | Carbonic anhydrase inhibitors: inhibition of the human isozymes I, II, VA, and IX with a library of substituted difluoromethanesulfonamides. Bioorg Med Chem Lett. 2005 Dec 1;15(23):5192-6. | |||||
| REF 23 | Carbonic anhydrase inhibitors. Regioselective synthesis of novel 1-substituted 1,4-dihydro-4-oxo-3-pyridinesulfonamides and their inhibition of the... Eur J Med Chem. 2010 Sep;45(9):3656-61. | |||||
| REF 24 | Carbonic anhydrase inhibitors. Design of anticonvulsant sulfonamides incorporating indane moieties. Bioorg Med Chem Lett. 2004 Dec 6;14(23):5781-6. | |||||
| REF 25 | Indanesulfonamides as carbonic anhydrase inhibitors. Toward structure-based design of selective inhibitors of the tumor-associated isozyme CA IX. J Med Chem. 2006 May 4;49(9):2743-9. | |||||
| REF 26 | Carbonic anhydrase inhibitors: inhibition of the tumor-associated isozymes IX and XII with a library of aromatic and heteroaromatic sulfonamides. Bioorg Med Chem Lett. 2005 Nov 1;15(21):4862-6. | |||||
| REF 27 | Synthesis, characterization and antiglaucoma activity of a novel proton transfer compound and a mixed-ligand Zn(II) complex. Bioorg Med Chem. 2010 Jan 15;18(2):930-8. | |||||
| REF 28 | Carbonic anhydrase inhibitors. Inhibition studies of a coral secretory isoform by sulfonamides. Bioorg Med Chem. 2009 Jul 15;17(14):5054-8. | |||||
| REF 29 | Carbonic anhydrase and matrix metalloproteinase inhibitors. Inhibition of human tumor-associated isozymes IX and cytosolic isozyme I and II with su... Bioorg Med Chem. 2007 Mar 15;15(6):2298-311. | |||||
| REF 30 | Carbonic anhydrase inhibitors. Inhibition of the fungal beta-carbonic anhydrases from Candida albicans and Cryptococcus neoformans with boronic acids. Bioorg Med Chem Lett. 2009 May 15;19(10):2642-5. | |||||
| REF 31 | Recent developments of carbonic anhydrase inhibitors as potential anticancer drugs. J Med Chem. 2008 Jun 12;51(11):3051-6. | |||||
| REF 32 | Carbonic anhydrase inhibitors. Novel sulfanilamide/acetazolamide derivatives obtained by the tail approach and their interaction with the cytosolic... Bioorg Med Chem Lett. 2005 Jan 17;15(2):367-72. | |||||
| REF 33 | Deciphering the mechanism of carbonic anhydrase inhibition with coumarins and thiocoumarins. J Med Chem. 2010 Jan 14;53(1):335-44. | |||||
| REF 34 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | |||||
| REF 35 | Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/membrane-associated carbonic anhydrase isozymes I, II, and IX with sulfonamide... J Med Chem. 2005 Mar 24;48(6):2121-5. | |||||
| REF 36 | Carbonic anhydrase inhibitors: Hypoxia-activatable sulfonamides incorporating disulfide bonds that target the tumor-associated isoform IX. J Med Chem. 2006 Sep 7;49(18):5544-51. | |||||
| REF 37 | Discovery of low nanomolar and subnanomolar inhibitors of the mycobacterial beta-carbonic anhydrases Rv1284 and Rv3273. J Med Chem. 2009 Jul 9;52(13):4063-7. | |||||
| REF 38 | Carbonic anhydrase inhibitors: synthesis and inhibition of the human cytosolic isozymes I and II and transmembrane isozymes IX, XII (cancer-associa... Eur J Med Chem. 2010 Jun;45(6):2396-404. | |||||
| REF 39 | In vitro inhibition of salicylic acid derivatives on human cytosolic carbonic anhydrase isozymes I and II. Bioorg Med Chem. 2008 Oct 15;16(20):9101-5. | |||||
| REF 40 | Carbonic anhydrase inhibitors. Design of fluorescent sulfonamides as probes of tumor-associated carbonic anhydrase IX that inhibit isozyme IX-media... J Med Chem. 2005 Jul 28;48(15):4834-41. | |||||
| REF 41 | Carbonic anhydrase inhibitors. Aromatic/heterocyclic sulfonamides incorporating phenacetyl, pyridylacetyl and thienylacetyl tails act as potent inh... Bioorg Med Chem. 2009 Jul 15;17(14):4894-9. | |||||
| REF 42 | Mutation of Phe91 to Asn in human carbonic anhydrase I unexpectedly enhanced both catalytic activity and affinity for sulfonamide inhibitors. Bioorg Med Chem. 2010 Aug 1;18(15):5498-503. | |||||
| REF 43 | Inhibition of carbonic anhydrases with glycosyltriazole benzene sulfonamides. J Med Chem. 2008 Mar 27;51(6):1945-53. | |||||
| REF 44 | Carbonic anhydrase inhibitors: the first on-resin screening of a 4-sulfamoylphenylthiourea library. J Med Chem. 2004 Oct 7;47(21):5224-9. | |||||
| REF 45 | Paraoxon, 4-nitrophenyl phosphate and acetate are substrates of - but not of -, - and -carbonic anhydrases. Bioorg Med Chem Lett. 2010 Nov 1;20(21):6208-12. | |||||
| REF 46 | A novel and one-pot synthesis of new 1-tosyl pyrrol-2-one derivatives and analysis of carbonic anhydrase inhibitory potencies. Bioorg Med Chem. 2010 Jun 15;18(12):4468-74. | |||||
| REF 47 | Carbonic anhydrase inhibitors. Synthesis of water-soluble, topically effective, intraocular pressure-lowering aromatic/heterocyclic sulfonamides co... J Med Chem. 1999 Jul 15;42(14):2641-50. | |||||
| REF 48 | Cloning, expression, post-translational modifications and inhibition studies on the latest mammalian carbonic anhydrase isoform, CA XV. J Med Chem. 2009 Feb 12;52(3):646-54. | |||||
| REF 49 | Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, and IX with sulfonamides d... Bioorg Med Chem Lett. 2004 Dec 6;14(23):5775-80. | |||||
| REF 50 | Carbonic anhydrase inhibitors: inhibition of the membrane-bound human isozyme IV with anions. Bioorg Med Chem Lett. 2004 Dec 6;14(23):5769-73. | |||||
| REF 51 | Ligand-directed tosyl chemistry for protein labeling in vivo. Nat Chem Biol. 2009 May;5(5):341-3. | |||||
| REF 52 | 7,8-disubstituted- but not 6,7-disubstituted coumarins selectively inhibit the transmembrane, tumor-associated carbonic anhydrase isoforms IX and X... Bioorg Med Chem Lett. 2010 Dec 15;20(24):7255-8. | |||||
| REF 53 | Carbonic anhydrase inhibitors. Inhibition of the beta-class enzyme from the methanoarchaeon Methanobacterium thermoautotrophicum (Cab) with anions. Bioorg Med Chem Lett. 2004 Sep 6;14(17):4563-7. | |||||
| REF 54 | Carbonic anhydrase inhibitors. Comparison of aliphatic sulfamate/bis-sulfamate adducts with isozymes II and IX as a platform for designing tight-bi... J Med Chem. 2009 Oct 8;52(19):5990-8. | |||||
| REF 55 | Polyamines inhibit carbonic anhydrases by anchoring to the zinc-coordinated water molecule. J Med Chem. 2010 Aug 12;53(15):5511-22. | |||||
| REF 56 | Carbonic anhydrase inhibitors. Inhibition of the newly isolated murine isozyme XIII with anions. Bioorg Med Chem Lett. 2004 Nov 1;14(21):5435-9. | |||||
| REF 57 | Dose-dependent pharmacokinetics of L-693,612, a carbonic anhydrase inhibitor, following oral administration in rats. Pharm Res. 1994 Mar;11(3):438-41. | |||||
| REF 58 | Therapeutic target database update 2012: a resource for facilitating target-oriented drug discovery. Nucleic Acids Res. 2012 Jan;40(Database issue):D1128-36. | |||||
| REF 59 | Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, IX, and XII with N-hydroxy... Bioorg Med Chem Lett. 2005 May 2;15(9):2353-8. | |||||
| REF 60 | Pteridine-sulfonamide conjugates as dual inhibitors of carbonic anhydrases and dihydrofolate reductase with potential antitumor activity. Bioorg Med Chem. 2010 Jul 15;18(14):5081-9. | |||||
| REF 61 | Carbonic anhydrase inhibitors: 2-substituted-1,3,4-thiadiazole-5-sulfamides act as powerful and selective inhibitors of the mitochondrial isozymes ... Bioorg Med Chem Lett. 2008 Dec 15;18(24):6332-5. | |||||
| REF 62 | Carbonic anhydrase inhibitors. Inhibition of the cytosolic and tumor-associated carbonic anhydrase isozymes I, II, and IX with a series of 1,3,4-th... Bioorg Med Chem Lett. 2005 May 2;15(9):2347-52. | |||||
| REF 63 | Carbonic anhydrase inhibitors: crystallographic and solution binding studies for the interaction of a boron-containing aromatic sulfamide with mamm... Bioorg Med Chem Lett. 2010 Jun 15;20(12):3601-5. | |||||
| REF 64 | Carbonic anhydrase inhibitors: inhibition of isozymes I, II and IV with N-hydroxysulfonamides--a novel class of intraocular pressure lowering agents. J Enzyme Inhib. 1998 Jul;13(4):267-84. | |||||
| REF 65 | A novel class of carbonic anhydrase inhibitors: glycoconjugate benzene sulfonamides prepared by "click-tailing". J Med Chem. 2006 Nov 2;49(22):6539-48. | |||||
| REF 66 | Carbonic anhydrase inhibitors. Inhibition of cytosolic isoforms I, II, III, VII and XIII with less investigated inorganic anions. Bioorg Med Chem Lett. 2009 Apr 1;19(7):1855-7. | |||||
| REF 67 | Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, and IX with bis-sulfamates. Bioorg Med Chem Lett. 2005 Feb 1;15(3):579-84. | |||||
| REF 68 | Carbonic anhydrase inhibitors: design of thioureido sulfonamides with potent isozyme II and XII inhibitory properties and intraocular pressure lowe... Bioorg Med Chem Lett. 2005 Sep 1;15(17):3821-7. | |||||
| REF 69 | Sulfenamido-sulfonamides as inhibitors of carbonic anhydrase isozymes I, II and IV. J Enzyme Inhib. 1997 Aug;12(3):175-90. | |||||
| REF 70 | Carbonic anhydrase inhibitors. Inhibition of isozymes I, II, IV, V and IX with complex fluorides, chlorides and cyanides. Bioorg Med Chem Lett. 2005 Apr 1;15(7):1909-13. | |||||
| REF 71 | Famotidine, an Antiulcer Agent, Strongly Inhibits Helicobacter pylori and Human Carbonic Anhydrases. ACS Med Chem Lett. 2018 Sep 4;9(10):1035-1038. | |||||
| REF 72 | The first example of a significant active site conformational rearrangement in a carbonic anhydrase-inhibitor adduct: the carbonic anhydrase I-topiramate complex. Org Biomol Chem. 2010 Aug 7;8(15):3528-33. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.