Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T16240
(Former ID: TTDI03590)
|
|||||
| Target Name |
Short transient receptor potential channel 2 (TRPC2)
|
|||||
| Synonyms |
Uncharacterized protein
Click to Show/Hide
|
|||||
| Gene Name |
TRPC2
|
|||||
| Target Type |
Literature-reported target
|
[1] | ||||
| Function |
Has calcium channel activity.
Click to Show/Hide
|
|||||
| BioChemical Class |
Transient receptor potential catioin channel
|
|||||
| UniProt ID | ||||||
| Sequence |
SCACLECSNARRYDLLKLSLSRINTYLGIASRAHLSLASEDAMLAAFQLSRELRRLARKE
PEFKPEYIALESLSQDYGFQLLGMCWNQSEVTAVLNDLAEDSETEPEAEGLGLAFEEGIP SLVRPRLAVNYNQKRFVAHLICQQVLSSI Click to Show/Hide
|
|||||
| Drug Property Profile of Target | Top | |
|---|---|---|
| (1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
|
||
| (3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
|
||
| (5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
|
||
| "RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five | ||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | A diacylglycerol-gated cation channel in vomeronasal neuron dendrites is impaired in TRPC2 mutant mice: mechanism of pheromone transduction. Neuron. 2003 Oct 30;40(3):551-61. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.