Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T23355
(Former ID: TTDR01362)
|
|||||
Target Name |
ITGB3 messenger RNA (ITGB3 mRNA)
|
|||||
Synonyms |
Platelet membrane glycoprotein IIIa (mRNA); Integrin beta-3 (mRNA); GPIIIa (mRNA); GP3A (mRNA); CD61 (mRNA)
Click to Show/Hide
|
|||||
Gene Name |
ITGB3
|
|||||
Target Type |
Discontinued target
|
[1] | ||||
Disease | [+] 2 Target-related Diseases | + | ||||
1 | Cardiovascular disease [ICD-11: BA00-BE2Z] | |||||
2 | Chronic arterial occlusive disease [ICD-11: BD4Z] | |||||
Function |
Integrin alpha-IIb/beta-3 (ITGA2B:ITGB3) is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. Integrins alpha-IIb/beta-3 and alpha-V/beta-3 recognize the sequence R-G-D in a wide array of ligands. Integrin alpha-IIb/beta-3 recognizes the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin alpha-IIb/beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen. This step leads to rapid platelet aggregation which physically plugs ruptured endothelial surface. Fibrinogen binding enhances SELP expression in activated platelets. ITGAV:ITGB3 binds to fractalkine (CX3CL1) and acts as its coreceptor in CX3CR1-dependent fractalkine signaling. ITGAV:ITGB3 binds to NRG1 (via EGF domain) and this binding is essential for NRG1-ERBB signaling. ITGAV:ITGB3 binds to FGF1 and this binding is essential for FGF1 signaling. ITGAV:ITGB3 binds to FGF2 and this binding is essential for FGF2 signaling. ITGAV:ITGB3 binds to IGF1 and this binding is essential for IGF1 signaling. ITGAV:ITGB3 binds to IGF2 and this binding is essential for IGF2 signaling. ITGAV:ITGB3 binds to IL1B and this binding is essential for IL1B signaling. ITGAV:ITGB3 binds to PLA2G2A via a site (site 2) which is distinct from the classical ligand-binding site (site 1) and this induces integrin conformational changes and enhanced ligand binding to site 1. ITGAV:ITGB3 acts as a receptor for fibrillin-1 (FBN1) and mediates R-G-D-dependent cell adhesion to FBN1. Integrin alpha-V/beta-3 (ITGAV:ITGB3) is a receptor for cytotactin, fibronectin, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin, vitronectin and von Willebrand factor.
Click to Show/Hide
|
|||||
BioChemical Class |
mRNA target
|
|||||
UniProt ID | ||||||
Sequence |
MRARPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLG
SPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRP DDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFG AFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSR NRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCH VGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLS MDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDT VSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGT FECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFG KITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLL CSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRY CRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDIL VVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTF TNITYRGT Click to Show/Hide
|
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
1 | XEMILOFIBAN | Drug Info | Discontinued in Phase 3 | Peripheral vascular disease | [2] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Inhibitor | [+] 63 Inhibitor drugs | + | ||||
1 | XEMILOFIBAN | Drug Info | [1] | |||
2 | DMP-802 | Drug Info | [3] | |||
3 | L-709780 | Drug Info | [4] | |||
4 | L-738167 | Drug Info | [3] | |||
5 | Ro-43-8857 | Drug Info | [3] | |||
6 | SB-223245 | Drug Info | [5] | |||
7 | SC-47643 | Drug Info | [6] | |||
8 | SKF-107260 | Drug Info | [7] | |||
9 | 3-(3-(benzamido)-5-nitrobenzamido)propanoic acid | Drug Info | [8] | |||
10 | 3-(3-(carbamoyl)benzamido)-3-phenylpropanoic acid | Drug Info | [8] | |||
11 | 3-(3-(carbamoyl)benzamido)propanoic acid | Drug Info | [8] | |||
12 | Ac-Asp-Arg-Leu-Asp-Ser-OH | Drug Info | [9] | |||
13 | C(-GRGDfL-) | Drug Info | [10] | |||
14 | C(Arg-Gly-Asp-D-Phe-Val) | Drug Info | [11] | |||
15 | C(RGDfF) | Drug Info | [12] | |||
16 | C(RGDfMeF) | Drug Info | [12] | |||
17 | C-[-Arg-Gly-Asp-Acpca30-] | Drug Info | [13] | |||
18 | C-[-Arg-Gly-Asp-Acpca31-] | Drug Info | [13] | |||
19 | C-[-Arg-Gly-Asp-Acpca32-] | Drug Info | [13] | |||
20 | Cyclo(RGDfV) (control) | Drug Info | [14] | |||
21 | Cyclo-[-Arg-Gly-Asp-Amp21-] | Drug Info | [15] | |||
22 | Cyclo-[-Arg-Gly-Asp-Amp22-] | Drug Info | [15] | |||
23 | Cyclo-[-Arg-Gly-Asp-Amp24-] | Drug Info | [15] | |||
24 | Cyclo-[-Arg-Gly-Asp-Amp25-] | Drug Info | [15] | |||
25 | Cyclo-[-Arg-Gly-Asp-Amp26-] | Drug Info | [15] | |||
26 | Cyclo-[-Arg-Gly-Asp-Amp27-] | Drug Info | [15] | |||
27 | Cyclo-[-Arg-Gly-Asp-Amp28-] | Drug Info | [15] | |||
28 | CYCLORGDFV | Drug Info | [16] | |||
29 | Cyclo[RGDfK(cypate)] | Drug Info | [14] | |||
30 | Cypate-[(RGD)2-NH2]1 | Drug Info | [14] | |||
31 | Cypate-[(RGD)2-NH2]2 | Drug Info | [14] | |||
32 | Cypate-[(RGD)3-NH2]1 | Drug Info | [14] | |||
33 | Cypate-[(RGD)4-NH2]2 | Drug Info | [14] | |||
34 | C[-Arg-Gly-Asp-Acpca19-] | Drug Info | [13] | |||
35 | C[-Arg-Gly-Asp-Acpca21-] | Drug Info | [13] | |||
36 | C[-Arg-Gly-Asp-Acpca22-] | Drug Info | [13] | |||
37 | C[-Arg-Gly-Asp-Acpca34-] | Drug Info | [13] | |||
38 | C[-Arg-Gly-Asp-Acpca35-] | Drug Info | [13] | |||
39 | C[-Arg-Gly-Asp-Acpca36-] | Drug Info | [13] | |||
40 | C[RGDf-(R)-alpha-TfmF] | Drug Info | [12] | |||
41 | C[RGDf-(R)-alpha-TfmV] | Drug Info | [12] | |||
42 | C[RGDf-(R)-N-Me-alpha-TfmF] | Drug Info | [12] | |||
43 | C[RGDf-(S)-alpha-TfmF] | Drug Info | [12] | |||
44 | C[RGDf-(S)-alpha-TfmV] | Drug Info | [12] | |||
45 | C[RGDf-(S)-N-Me-alpha-TfmF] | Drug Info | [12] | |||
46 | E[c(RGDyK)]2 | Drug Info | [17] | |||
47 | E[c(RGDyK)]2-PTX conjugate | Drug Info | [17] | |||
48 | Gly-Arg-Gly-Asp-Ser | Drug Info | [18] | |||
49 | Gly-Arg-Gly-Asp-Ser-Pro-Lys | Drug Info | [19] | |||
50 | ISONIPECOTAMIDE | Drug Info | [21] | |||
51 | L-734115 | Drug Info | [3] | |||
52 | L-739758 | Drug Info | [3] | |||
53 | L-746233 | Drug Info | [3] | |||
54 | L-750034 | Drug Info | [22] | |||
55 | L-756568 | Drug Info | [3] | |||
56 | N-(3,5-dichlorophenyl)imidodicarbonimidic diamide | Drug Info | [23] | |||
57 | RGDechi | Drug Info | [11] | |||
58 | ROXIFIBAN | Drug Info | [3] | |||
59 | RWJ-53419 | Drug Info | [24] | |||
60 | SB-207043 | Drug Info | [7] | |||
61 | SB-265123 | Drug Info | [25] | |||
62 | SC-54701A | Drug Info | [26] | |||
63 | ST-1646 | Drug Info | [15] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Potent, orally active GPIIb/IIIa antagonists containing a nipecotic acid subunit. Structure-activity studies leading to the discovery of RWJ-53308. J Med Chem. 1999 Dec 16;42(25):5254-65. | |||||
REF 2 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004434) | |||||
REF 3 | Platelet glycoprotein IIb-IIIa antagonists as prototypical integrin blockers: novel parenteral and potential oral antithrombotic agents. J Med Chem. 2000 Sep 21;43(19):3453-73. | |||||
REF 4 | Non-peptide fibrinogen receptor antagonists. 3. design and discovery of a centrally constrained inhibitorc, Bioorg. Med. Chem. Lett. 4(15):1835-1840 (1994). | |||||
REF 5 | Discovery of an imidazopyridine-containing 1,4-benzodiazepine nonpeptide vitronectin receptor (alpha v beta 3) antagonist with efficacy in a resten... Bioorg Med Chem Lett. 1998 Nov 17;8(22):3171-6. | |||||
REF 6 | Novel thiazole-based heterocycles as selective inhibitors of fibrinogen-mediated platelet aggregation. J Med Chem. 1995 Jan 6;38(1):34-41. | |||||
REF 7 | Preparation and Properties of a fibrinogen receptor antagonist containing the Arg-Gly-Asp sequence and nitroxide radicals, Bioorg. Med. Chem. Lett. 3(6):1179-1184 (1993). | |||||
REF 8 | Derivatives of 7-amino-1,2,3,4-tetrahydroisoquinoline and isophthalic acids as novel fibrinogen receptor antagonists. Bioorg Med Chem Lett. 2006 Oct 15;16(20):5294-7. | |||||
REF 9 | Synthesis and biological evaluation of non-peptide alpha(v)beta(3)/alpha(5)beta(1) integrin dual antagonists containing 5,6-dihydropyridin-2-one sc... Bioorg Med Chem. 2007 Dec 1;15(23):7380-90. | |||||
REF 10 | Multiple N-methylation by a designed approach enhances receptor selectivity. J Med Chem. 2007 Nov 29;50(24):5878-81. | |||||
REF 11 | Novel and selective alpha(v)beta3 receptor peptide antagonist: design, synthesis, and biological behavior. J Med Chem. 2006 Jun 1;49(11):3416-20. | |||||
REF 12 | Incorporation of the unusual C(alpha)-fluoroalkylamino acids into cyclopeptides: synthesis of arginine-glycine-aspartate (RGD) analogues and study ... J Med Chem. 2006 Mar 9;49(5):1808-17. | |||||
REF 13 | Grafting aminocyclopentane carboxylic acids onto the RGD tripeptide sequence generates low nanomolar alphaVbeta3/alphaVbeta5 integrin dual binders. J Med Chem. 2005 Dec 1;48(24):7675-87. | |||||
REF 14 | Design, synthesis, and evaluation of near infrared fluorescent multimeric RGD peptides for targeting tumors. J Med Chem. 2006 Apr 6;49(7):2268-75. | |||||
REF 15 | Discovery of subnanomolar arginine-glycine-aspartate-based alphaVbeta3/alphaVbeta5 integrin binders embedding 4-aminoproline residues. J Med Chem. 2008 Mar 27;51(6):1771-82. | |||||
REF 16 | Antiangiogenic effect of dual/selective alpha(5)beta(1)/alpha(v)beta(3) integrin antagonists designed on partially modified retro-inverso cyclotetr... J Med Chem. 2010 Jan 14;53(1):106-18. | |||||
REF 17 | Synthesis and biological evaluation of dimeric RGD peptide-paclitaxel conjugate as a model for integrin-targeted drug delivery. J Med Chem. 2005 Feb 24;48(4):1098-106. | |||||
REF 18 | alphavbeta3 Integrin-targeting Arg-Gly-Asp (RGD) peptidomimetics containing oligoethylene glycol (OEG) spacers. J Med Chem. 2009 Nov 26;52(22):7029-43. | |||||
REF 19 | N-Methylated cyclic RGD peptides as highly active and selective alpha(V)beta(3) integrin antagonists. J Med Chem. 1999 Aug 12;42(16):3033-40. | |||||
REF 20 | US patent application no. 7,425,545, Modulation of C-reactive protein expression. | |||||
REF 21 | Piperidine-containing beta-arylpropionic acids as potent antagonists of alphavbeta3/alphavbeta5 integrins. Bioorg Med Chem Lett. 2004 Oct 18;14(20):5227-32. | |||||
REF 22 | Molecular model of the alpha(IIb)beta(3) integrin. J Med Chem. 2003 Dec 4;46(25):5316-25. | |||||
REF 23 | Emerging targets in osteoporosis disease modification. J Med Chem. 2010 Jun 10;53(11):4332-53. | |||||
REF 24 | 1,2,4-triazolo[3,4-a]pyridine as a novel, constrained template for fibrinogen receptor (GPIIb/IIIa) antagonists. Bioorg Med Chem Lett. 2001 Oct 8;11(19):2619-22. | |||||
REF 25 | 1,2,3,4-Tetrahydroquinoline-containing alphaVbeta3 integrin antagonists with enhanced oral bioavailability. Bioorg Med Chem Lett. 2004 Dec 6;14(23):5937-41. | |||||
REF 26 | Use of conformationally restricted benzamidines as arginine surrogates in the design of platelet GPIIb-IIIa receptor antagonists. J Med Chem. 1997 Aug 29;40(18):2843-57. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.