Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T78709
(Former ID: TTDS00098)
|
|||||
Target Name |
5-HT 1A receptor (HTR1A)
|
|||||
Synonyms |
Serotonin receptor 1A; G-21; ADRBRL1; ADRB2RL1; 5-hydroxytryptamine receptor 1A; 5-HT1A receptor; 5-HT1A; 5-HT-1A
Click to Show/Hide
|
|||||
Gene Name |
HTR1A
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 5 Target-related Diseases | + | ||||
1 | Anxiety disorder [ICD-11: 6B00-6B0Z] | |||||
2 | Depression [ICD-11: 6A70-6A7Z] | |||||
3 | Hypertension [ICD-11: BA00-BA04] | |||||
4 | Migraine [ICD-11: 8A80] | |||||
5 | Mood disorder [ICD-11: 6A60-6E23] | |||||
Function |
Functions as a receptor for various drugs and psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling inhibits adenylate cyclase activity and activates a phosphatidylinositol-calcium second messenger system that regulates the release of Ca(2+) ions from intracellular stores. Plays a role in the regulation of 5-hydroxytryptamine release and in the regulation of dopamine and 5-hydroxytryptamine metabolism. Plays a role in the regulation of dopamine and 5-hydroxytryptamine levels in the brain, and thereby affects neural activity, mood and behavior. Plays a role in the response to anxiogenic stimuli. G-protein coupled receptor for 5-hydroxytryptamine (serotonin).
Click to Show/Hide
|
|||||
BioChemical Class |
GPCR rhodopsin
|
|||||
UniProt ID | ||||||
Sequence |
MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC RQ Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
HIT2.0 ID | T31QEZ |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 7 Approved Drugs | + | ||||
1 | Flibanserin | Drug Info | Approved | Mood disorder | [6], [7] | |
2 | Gepirone | Drug Info | Approved | Major depressive disorder | [8] | |
3 | OPC-34712 | Drug Info | Approved | Major depressive disorder | [9], [10] | |
4 | TERTATOLOL | Drug Info | Approved | Hypertension | [11], [12] | |
5 | Trazodone | Drug Info | Approved | Depression | [13], [14] | |
6 | Treximet | Drug Info | Approved | Migraine | [15] | |
7 | Urapidil | Drug Info | Approved | Hypertension | [12] | |
Clinical Trial Drug(s) | [+] 28 Clinical Trial Drugs | + | ||||
1 | Eltoprazine | Drug Info | Phase 3 | Attention deficit hyperactivity disorder | [17] | |
2 | SEP-363856 | Drug Info | Phase 3 | Schizophrenia | [18] | |
3 | Xaliproden | Drug Info | Phase 3 | Juvenile idiopathic arthritis | [19] | |
4 | LECOZOTAN HYDROCHLORIDE | Drug Info | Phase 2/3 | Cognitive impairment | [21] | |
5 | Ensaculin hydrochloride | Drug Info | Phase 2 | Parkinson disease | [23] | |
6 | FKW00GA | Drug Info | Phase 2 | Social phobia | [17] | |
7 | Mazapertine succinate | Drug Info | Phase 2 | Psychotic disorder | [24] | |
8 | MN-305 | Drug Info | Phase 2 | Mood disorder | [25] | |
9 | Neu-P11 | Drug Info | Phase 2 | Insomnia | [26] | |
10 | OPC-14523 | Drug Info | Phase 2 | Mood disorder | [27] | |
11 | ORG-13011 | Drug Info | Phase 2 | Psychotic disorder | [28] | |
12 | RP5063 | Drug Info | Phase 2 | Schizophrenia | [29] | |
13 | S-15535 | Drug Info | Phase 2 | Anxiety disorder | [30], [31] | |
14 | S-16924 | Drug Info | Phase 2 | Anxiety disorder | [32], [33], [34] | |
15 | SDZ-MAR-327 | Drug Info | Phase 2 | Psychotic disorder | [35], [36] | |
16 | SUN N4057 | Drug Info | Phase 2 | Coronary artery disease | [37] | |
17 | TGBA01AD | Drug Info | Phase 2 | Mood disorder | [25] | |
18 | TGFK08AA | Drug Info | Phase 2 | Generalized anxiety disorder | [38] | |
19 | TGFK09SD | Drug Info | Phase 2 | Hypoactive sexual desire dysfunction | [39] | |
20 | TGWOOAA | Drug Info | Phase 2 | Social phobia | [40] | |
21 | Zalospirone | Drug Info | Phase 2 | Anxiety disorder | [41], [42] | |
22 | 1192U90 | Drug Info | Phase 1 | Psychotic disorder | [44] | |
23 | AV-965 | Drug Info | Phase 1 | Alzheimer disease | [45] | |
24 | GSK-958108 | Drug Info | Phase 1 | Premature ejaculation | [46] | |
25 | NLX-101 | Drug Info | Phase 1 | Rett syndrome | [47] | |
26 | SKL-PSY | Drug Info | Phase 1 | Bipolar disorder | [48] | |
27 | SSR-181507 | Drug Info | Phase 1 | Schizophrenia | [35] | |
28 | Umespirone | Drug Info | Phase 1 | Anxiety disorder | [49] | |
Patented Agent(s) | [+] 5 Patented Agents | + | ||||
1 | PMID30124346-Compound-13TABLE4 | Drug Info | Patented | Attention deficit hyperactivity disorder | [50] | |
2 | PMID30124346-Compound-34TABLE4 | Drug Info | Patented | Attention deficit hyperactivity disorder | [50] | |
3 | PMID30124346-Compound-60TABLE5 | Drug Info | Patented | Parkinson disease | [50], [51], [52] | |
4 | PMID30124346-Compound-LDT66 | Drug Info | Patented | Benign prostatic hyperplasia | [50] | |
5 | PMID30124346-Compound-LDT8 | Drug Info | Patented | Benign prostatic hyperplasia | [50] | |
Discontinued Drug(s) | [+] 32 Discontinued Drugs | + | ||||
1 | LYSERGIC ACID DIETHYLAMIDE | Drug Info | Withdrawn from market | Addictive disorder | [53], [54] | |
2 | Bifeprunox | Drug Info | Discontinued in Phase 3 | Schizophrenia | [35] | |
3 | BMS-181100 | Drug Info | Discontinued in Phase 3 | Psychotic disorder | [55], [56] | |
4 | Flesinoxan | Drug Info | Discontinued in Phase 3 | Anxiety disorder | [57], [58] | |
5 | ALNESPIRONE | Drug Info | Discontinued in Phase 2 | Anxiety disorder | [60] | |
6 | AP-521 | Drug Info | Discontinued in Phase 2 | Anxiety disorder | [61] | |
7 | GSK163090 | Drug Info | Discontinued in Phase 2 | Anxiety disorder | [62] | |
8 | LESOPITRON DIHYDROCHLORIDE | Drug Info | Discontinued in Phase 2 | Mood disorder | [63] | |
9 | PRX-00023 | Drug Info | Discontinued in Phase 2 | Mood disorder | [25] | |
10 | REC-15/3079 | Drug Info | Discontinued in Phase 2 | Urinary incontinence | [64], [65] | |
11 | Robalzotan | Drug Info | Discontinued in Phase 2 | Anxiety disorder | [66], [67] | |
12 | BINOSPIRONE MESYLATE | Drug Info | Discontinued in Phase 1 | Anxiety disorder | [68] | |
13 | DU-29894 | Drug Info | Discontinued in Phase 1 | Psychotic disorder | [69] | |
14 | E2101 | Drug Info | Discontinued in Phase 1 | Spasm | [70] | |
15 | Ebalzotan | Drug Info | Discontinued in Phase 1 | Anxiety disorder | [71] | |
16 | Eptapirone | Drug Info | Discontinued in Phase 1 | Anxiety disorder | [72] | |
17 | GR-127607 | Drug Info | Discontinued in Phase 1 | Migraine | [73] | |
18 | Nerisopam | Drug Info | Discontinued in Phase 1 | Anxiety disorder | [74] | |
19 | SLV-313 | Drug Info | Discontinued in Phase 1 | Schizophrenia | [35] | |
20 | SUN-8399 | Drug Info | Discontinued in Phase 1 | Anxiety disorder | [75] | |
21 | U-93385 | Drug Info | Discontinued in Phase 1 | Anxiety disorder | [76] | |
22 | A-74283 | Drug Info | Terminated | Hypertension | [79] | |
23 | Anpirtoline | Drug Info | Terminated | Pain | [80] | |
24 | BTS-79018 | Drug Info | Terminated | Schizophrenia | [35] | |
25 | CGS-18102A | Drug Info | Terminated | Anxiety disorder | [81] | |
26 | Du-123015 | Drug Info | Terminated | Anxiety disorder | [82] | |
27 | HT-90B | Drug Info | Terminated | Anxiety disorder | [83] | |
28 | Ipsapirone | Drug Info | Terminated | Anxiety disorder | [84], [85] | |
29 | LY-293284 | Drug Info | Terminated | Anxiety disorder | [86], [87] | |
30 | RWJ-25730 | Drug Info | Terminated | Psychotic disorder | [88] | |
31 | S-14506 | Drug Info | Terminated | Anxiety disorder | [89], [90] | |
32 | WAY-100635 | Drug Info | Terminated | Eating disorder | [91], [92] | |
Preclinical Drug(s) | [+] 2 Preclinical Drugs | + | ||||
1 | CM-2236 | Drug Info | Preclinical | Post-traumatic stress disorder | [77] | |
2 | PD-158771 | Drug Info | Preclinical | Schizophrenia | [35] | |
Mode of Action | [+] 6 Modes of Action | + | ||||
Modulator | [+] 32 Modulator drugs | + | ||||
1 | Flibanserin | Drug Info | [7] | |||
2 | OPC-34712 | Drug Info | [93], [94] | |||
3 | Trazodone | Drug Info | [96] | |||
4 | Ensaculin hydrochloride | Drug Info | [23], [102] | |||
5 | FKB01MD | Drug Info | [17] | |||
6 | Mazapertine succinate | Drug Info | [103] | |||
7 | OPC-14523 | Drug Info | [105] | |||
8 | S-16924 | Drug Info | [33], [34] | |||
9 | SDZ-MAR-327 | Drug Info | [111] | |||
10 | TGBA01AD | Drug Info | [113] | |||
11 | TGFK08AA | Drug Info | [114] | |||
12 | TGFK09SD | Drug Info | [115] | |||
13 | NLX-101 | Drug Info | [119] | |||
14 | SKL-PSY | Drug Info | [120] | |||
15 | SSR-181507 | Drug Info | [121] | |||
16 | Bifeprunox | Drug Info | [124] | |||
17 | BMS-181100 | Drug Info | [125], [126] | |||
18 | PRX-00023 | Drug Info | [134] | |||
19 | DU-29894 | Drug Info | [138] | |||
20 | E2101 | Drug Info | [139] | |||
21 | SLV-313 | Drug Info | [144] | |||
22 | Anpirtoline | Drug Info | [80] | |||
23 | CGS-18102A | Drug Info | [151] | |||
24 | Du-123015 | Drug Info | [152] | |||
25 | HT-90B | Drug Info | [153] | |||
26 | RWJ-25730 | Drug Info | [157] | |||
27 | S-14506 | Drug Info | [158] | |||
28 | CGS-19480A | Drug Info | [198], [12] | |||
29 | EMD 56551 | Drug Info | [201] | |||
30 | NPT-500 | Drug Info | [120] | |||
31 | SEL-73 | Drug Info | [120] | |||
32 | SR-59026 | Drug Info | [221] | |||
Agonist | [+] 44 Agonist drugs | + | ||||
1 | Gepirone | Drug Info | [8] | |||
2 | Urapidil | Drug Info | [98] | |||
3 | Eltoprazine | Drug Info | [99] | |||
4 | SEP-363856 | Drug Info | [20] | |||
5 | MN-305 | Drug Info | [25] | |||
6 | Neu-P11 | Drug Info | [104] | |||
7 | SUN N4057 | Drug Info | [112] | |||
8 | Zalospirone | Drug Info | [42] | |||
9 | 1192U90 | Drug Info | [35] | |||
10 | Aryl piperazine derivative 14 | Drug Info | [50] | |||
11 | Aryl piperazine derivative 15 | Drug Info | [50] | |||
12 | Aryl piperazine derivative 16 | Drug Info | [50] | |||
13 | PMID30124346-Compound-13TABLE4 | Drug Info | [50] | |||
14 | Flesinoxan | Drug Info | [127] | |||
15 | ALNESPIRONE | Drug Info | [130], [12] | |||
16 | AP-521 | Drug Info | [131], [12] | |||
17 | LESOPITRON DIHYDROCHLORIDE | Drug Info | [132] | |||
18 | Ebalzotan | Drug Info | [140] | |||
19 | Eptapirone | Drug Info | [141] | |||
20 | GR-127607 | Drug Info | [142] | |||
21 | Nerisopam | Drug Info | [143] | |||
22 | SUN-8399 | Drug Info | [145] | |||
23 | U-93385 | Drug Info | [146], [12] | |||
24 | CM-2236 | Drug Info | [147] | |||
25 | A-74283 | Drug Info | [148] | |||
26 | Ipsapirone | Drug Info | [154] | |||
27 | LY-293284 | Drug Info | [155] | |||
28 | 1-naphthylpiperazine | Drug Info | [178], [168] | |||
29 | 5-CT | Drug Info | [194] | |||
30 | 7-methoxy-1-naphthylpiperazine | Drug Info | [178] | |||
31 | BRL-15572 | Drug Info | [197] | |||
32 | CP 93129 | Drug Info | [194] | |||
33 | EDMT | Drug Info | [200] | |||
34 | FG-5893 | Drug Info | [203] | |||
35 | L-772,405 | Drug Info | [205] | |||
36 | LP-211 | Drug Info | [206] | |||
37 | LY 165,163 | Drug Info | [203] | |||
38 | piribedil | Drug Info | [213] | |||
39 | S-14671 | Drug Info | [110] | |||
40 | SB 216641 | Drug Info | [197] | |||
41 | spiroxatrine | Drug Info | [203] | |||
42 | U92016A | Drug Info | [222] | |||
43 | [3H]8-OH-DPAT | Drug Info | [227] | |||
44 | [3H]NLX-112 | Drug Info | [228] | |||
Inhibitor | [+] 129 Inhibitor drugs | + | ||||
1 | TERTATOLOL | Drug Info | [95] | |||
2 | LYSERGIC ACID DIETHYLAMIDE | Drug Info | [123] | |||
3 | Sunepitron | Drug Info | [128] | |||
4 | TIOSPIRONE | Drug Info | [129] | |||
5 | MAZAPERTINE | Drug Info | [133] | |||
6 | A-80426 | Drug Info | [149] | |||
7 | BMY-7378 | Drug Info | [150] | |||
8 | WB-4101 | Drug Info | [163] | |||
9 | (3-Chloro-phenyl)-piperazin-1-yl-methanone | Drug Info | [164] | |||
10 | (R)-(-)-10-methyl-11-hydroxyaporphine | Drug Info | [165] | |||
11 | (R)-11-Amino-2-methoxyaporphine | Drug Info | [166] | |||
12 | (R)-2,11-Diaminoaporphine | Drug Info | [166] | |||
13 | 1,2,3,4-Tetrahydro-naphthalen-2-ylamine | Drug Info | [168] | |||
14 | 1,6-bis(4-(3-chlorophenyl)piperazin-1-yl)hexane | Drug Info | [169] | |||
15 | 1,6-bis(4-(3-methoxyphenyl)piperazin-1-yl)hexane | Drug Info | [169] | |||
16 | 1,6-bis(4-(pyridin-2-yl)piperazin-1-yl)hexane | Drug Info | [169] | |||
17 | 1,6-bis(4-m-tolylpiperazin-1-yl)hexane | Drug Info | [169] | |||
18 | 1,6-bis(4-phenylpiperazin-1-yl)hexane | Drug Info | [169] | |||
19 | 1-((S)-2-aminopropyl)-1H-indazol-6-ol | Drug Info | [170] | |||
20 | 1-(2,5-Dimethoxy-4-methyl-phenyl)-piperazine | Drug Info | [164] | |||
21 | 1-(2,5-Dimethoxy-phenyl)-piperazine | Drug Info | [164] | |||
22 | 1-(2,5-dimethoxyphenyl)propan-2-amine | Drug Info | [171] | |||
23 | 1-(2-(2-fluorobenzyloxy)phenyl)piperazine | Drug Info | [172] | |||
24 | 1-(2-(3-fluorophenoxy)phenyl)piperazine | Drug Info | [172] | |||
25 | 1-(2-(4-fluorophenoxy)phenyl)piperazine | Drug Info | [172] | |||
26 | 1-(2-(phenoxymethyl)phenyl)piperazine | Drug Info | [172] | |||
27 | 1-(2-Butoxy-phenyl)-piperazine | Drug Info | [173] | |||
28 | 1-(2-Chloro-phenyl)-piperazine | Drug Info | [174] | |||
29 | 1-(2-Ethoxy-phenyl)-piperazine | Drug Info | [173] | |||
30 | 1-(2-Fluoro-phenyl)-piperazine | Drug Info | [173] | |||
31 | 1-(2-Isopropoxy-phenyl)-piperazine | Drug Info | [173] | |||
32 | 1-(2-Methoxy-phenyl)-4-propyl-piperazine | Drug Info | [175] | |||
33 | 1-(2-methoxyphenyl)-4-pentylpiperazine | Drug Info | [176] | |||
34 | 1-(2-phenoxyphenyl)piperazine | Drug Info | [172] | |||
35 | 1-(3-(pentafluorosulfanyl)phenyl)propan-2-amine | Drug Info | [177] | |||
36 | 1-(3-Fluoro-phenyl)-piperazine | Drug Info | [173] | |||
37 | 1-(3-Nitro-phenyl)-piperazine | Drug Info | [173] | |||
38 | 1-(4-Bromo-2,5-dimethoxy-phenyl)-piperazine | Drug Info | [164] | |||
39 | 1-(7-Methoxy-naphthalen-2-yl)-piperazine | Drug Info | [178] | |||
40 | 1-(benzyloxy)-2-(2-phenylethyl)benzene | Drug Info | [179] | |||
41 | 1-(benzyloxy)-2-[2-(3-methoxyphenyl)ethyl]benzene | Drug Info | [179] | |||
42 | 1-Benzyl-4-chroman-2-ylmethyl-piperazine | Drug Info | [180] | |||
43 | 1-Butyl-4-(2-methoxy-phenyl)-piperazine | Drug Info | [175] | |||
44 | 1-Ethyl-4-(2-methoxy-phenyl)-piperazine | Drug Info | [175] | |||
45 | 1-Methyl-1,3-dihydro-indol-2-one | Drug Info | [181] | |||
46 | 1-Propyl-3-(3-trifluoromethyl-phenyl)-pyrrolidine | Drug Info | [182] | |||
47 | 1-[(3-methoxybenzyl)oxy]-2-(2-phenylethyl)benzene | Drug Info | [179] | |||
48 | 2-(2'-methyl-biphenyl-3-yl)-ethylamine | Drug Info | [183] | |||
49 | 2-(2-Amino-propyl)-5-bromo-4-methoxy-phenol | Drug Info | [171] | |||
50 | 2-(2-chlorophenoxy)-3-(piperidin-4-yl)pyridine | Drug Info | [184] | |||
51 | 2-(2-fluorophenoxy)-3-(piperidin-4-yl)pyridine | Drug Info | [184] | |||
52 | 2-(2-Methoxy-phenyl)-1-methyl-ethylamine | Drug Info | [171] | |||
53 | 2-(2-methoxyphenoxy)-3-(piperidin-4-yl)pyridine | Drug Info | [184] | |||
54 | 2-(3-Bromophenylthio)-N,N-dimethylethanamine | Drug Info | [185] | |||
55 | 2-(3-Methoxy-phenyl)-1-methyl-ethylamine | Drug Info | [171] | |||
56 | 2-(4-Benzyl-piperidin-1-ylmethyl)-chroman-4-one | Drug Info | [180] | |||
57 | 2-(4-Bromo-2-methoxy-phenyl)-1-methyl-ethylamine | Drug Info | [171] | |||
58 | 2-(4-Bromo-phenyl)-1-methyl-ethylamine | Drug Info | [171] | |||
59 | 2-(4-Methyl-piperazin-1-yl)-4-phenyl-pyrimidine | Drug Info | [186] | |||
60 | 2-(5-Methoxy-1H-indol-3-yl)-1-methyl-ethylamine | Drug Info | [187] | |||
61 | 2-(Biphenyl-3-ylthio)-N,N-dimethylethanamine | Drug Info | [185] | |||
62 | 2-Dipropylamino-1,2,3,4-tetrahydro-anthracen-9-ol | Drug Info | [95] | |||
63 | 2-phenoxy-3-(piperidin-4-yl)pyridine | Drug Info | [184] | |||
64 | 2-Piperazin-1-yl-benzonitrile | Drug Info | [173] | |||
65 | 2-Piperazin-1-yl-phenol | Drug Info | [164] | |||
66 | 2-{[2-(2-phenylethyl)phenoxy]methyl}pyridine | Drug Info | [179] | |||
67 | 3-(1,2,3,6-Tetrahydro-pyridin-4-yl)-1H-indole | Drug Info | [188] | |||
68 | 3-(1-Propyl-pyrrolidin-3-yl)-phenol | Drug Info | [182] | |||
69 | 3-(2-Amino-propyl)-1H-indol-5-ol | Drug Info | [187] | |||
70 | 3-(2-Benzylamino-ethoxy)-phenol | Drug Info | [189] | |||
71 | 3-(3-Methanesulfonyl-phenyl)-1-propyl-pyrrolidine | Drug Info | [182] | |||
72 | 3-(4-Benzyl-piperidin-1-ylmethyl)-chroman-4-one | Drug Info | [180] | |||
73 | 3-(4-Benzyl-piperidin-1-ylmethyl)-chromen-4-one | Drug Info | [180] | |||
74 | 3-(piperidin-4-yl)-2-(o-tolyloxy)pyridine | Drug Info | [184] | |||
75 | 3-Amino-1-(2-amino-5-methoxy-phenyl)-propan-1-one | Drug Info | [164] | |||
76 | 3-Butyl-2,3,4,5-tetrahydro-1H-benzo[d]azepin-6-ol | Drug Info | [190] | |||
77 | 3-Ethyl-2,3,4,5-tetrahydro-1H-benzo[d]azepin-6-ol | Drug Info | [190] | |||
78 | 3-Naphthalen-1-yl-1-propyl-pyrrolidine | Drug Info | [182] | |||
79 | 3-Naphthalen-1-yl-pyrrolidine | Drug Info | [182] | |||
80 | 3-Phenyl-1-propyl-pyrrolidine | Drug Info | [182] | |||
81 | 3-{[2-(2-phenylethyl)phenoxy]methyl}pyridine | Drug Info | [179] | |||
82 | 4-(1H-indol-4-yloxy)-1-(isopropylamino)butan-2-ol | Drug Info | [191] | |||
83 | 4-(2-(2-fluoro-5-methylphenoxy)phenyl)piperidine | Drug Info | [172] | |||
84 | 4-(2-(2-fluorobenzyloxy)phenyl)piperidine | Drug Info | [172] | |||
85 | 4-(2-(3-chlorophenoxy)phenyl)piperidine | Drug Info | [172] | |||
86 | 4-(2-(3-fluorophenoxy)phenyl)piperidine | Drug Info | [172] | |||
87 | 4-(2-(4-fluorobenzyloxy)phenyl)piperidine | Drug Info | [172] | |||
88 | 4-(2-(4-fluorophenoxy)phenyl)piperidine | Drug Info | [172] | |||
89 | 4-(2-(benzyloxy)-3-fluorophenyl)piperidine | Drug Info | [172] | |||
90 | 4-(2-(benzyloxy)-6-fluorophenyl)piperidine | Drug Info | [172] | |||
91 | 4-(2-(benzyloxy)phenyl)piperidine | Drug Info | [172] | |||
92 | 4-(2-fluoro-6-(3-fluorophenoxy)phenyl)piperidine | Drug Info | [172] | |||
93 | 4-(2-fluoro-6-(4-fluorophenoxy)phenyl)piperidine | Drug Info | [172] | |||
94 | 4-(2-fluoro-6-phenoxyphenyl)piperidine | Drug Info | [172] | |||
95 | 4-(2-phenoxyphenyl)piperidine | Drug Info | [172] | |||
96 | 4-(3-fluoro-2-phenoxyphenyl)piperidine | Drug Info | [172] | |||
97 | 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [192] | |||
98 | 4-Benzyl-1-chroman-2-ylmethyl-piperidine | Drug Info | [180] | |||
99 | 4-Benzyl-1-chroman-3-ylmethyl-piperidine | Drug Info | [180] | |||
100 | 5,6-dichloro-3,4-dihydroquinazolin-2-amine | Drug Info | [193] | |||
101 | 5-chloro-4-ethyl-3,4-dihydroquinazolin-2-amine | Drug Info | [193] | |||
102 | 5-chloro-4-methyl-3,4-dihydroquinazolin-2-amine | Drug Info | [193] | |||
103 | 8-Methoxy-1,2,3,4-tetrahydro-naphthalen-2-ylamine | Drug Info | [95] | |||
104 | 8-Methoxy-2-(4-methyl-piperazin-1-yl)-quinoline | Drug Info | [168] | |||
105 | 8-Methoxy-2-piperazin-1-yl-quinoline | Drug Info | [168] | |||
106 | 8-Methoxy-quinolin-2-ylamine | Drug Info | [168] | |||
107 | 9-Methoxy-1,2,3,4-tetrahydro-anthracen-2-ylamine | Drug Info | [95] | |||
108 | A-987306 | Drug Info | [195] | |||
109 | AGROCLAVINE | Drug Info | [196] | |||
110 | Brolamfetamine | Drug Info | [171] | |||
111 | ESCHOLTZINE | Drug Info | [202] | |||
112 | JNJ-10392980 | Drug Info | [204] | |||
113 | MCL-516 | Drug Info | [166] | |||
114 | N-(3-(1H-indol-4-yloxy)propyl)cyclohexanamine | Drug Info | [191] | |||
115 | N-(3-(1H-indol-4-yloxy)propyl)cyclopentanamine | Drug Info | [191] | |||
116 | N-Benzyl-4-(2-diphenyl)-1-piperazinehexanamide | Drug Info | [206] | |||
117 | N-methyllaurotetanine | Drug Info | [202] | |||
118 | N-[4-(4-Phenyl-piperazin-1-yl)-butyl]-benzamide | Drug Info | [208] | |||
119 | PB-28 | Drug Info | [211] | |||
120 | PG-01037 | Drug Info | [212] | |||
121 | QUIPAZINE | Drug Info | [214] | |||
122 | SB-271046 | Drug Info | [218] | |||
123 | SB-656104 | Drug Info | [219] | |||
124 | SEROTONIN | Drug Info | [214] | |||
125 | SNAP-8719 | Drug Info | [220] | |||
126 | UH-232 | Drug Info | [223] | |||
127 | UH-301 | Drug Info | [224] | |||
128 | WAY-466 | Drug Info | [225] | |||
129 | [3H]spiperone | Drug Info | [163] | |||
Antagonist | [+] 34 Antagonist drugs | + | ||||
1 | Treximet | Drug Info | [97] | |||
2 | Xaliproden | Drug Info | [100] | |||
3 | LECOZOTAN HYDROCHLORIDE | Drug Info | [12], [101] | |||
4 | FKW00GA | Drug Info | [17] | |||
5 | ORG-13011 | Drug Info | [12], [106] | |||
6 | RP5063 | Drug Info | [107], [108] | |||
7 | S-15535 | Drug Info | [12], [109], [110] | |||
8 | TGWOOAA | Drug Info | [116] | |||
9 | AV-965 | Drug Info | [117] | |||
10 | GSK-958108 | Drug Info | [118] | |||
11 | Umespirone | Drug Info | [122] | |||
12 | PMID30124346-Compound-LDT8 | Drug Info | [50] | |||
13 | GSK163090 | Drug Info | [97] | |||
14 | REC-15/3079 | Drug Info | [135] | |||
15 | Robalzotan | Drug Info | [136] | |||
16 | BINOSPIRONE MESYLATE | Drug Info | [137], [12] | |||
17 | PD-158771 | Drug Info | [35] | |||
18 | NAN-190 | Drug Info | [156] | |||
19 | SDZ 216-525 | Drug Info | [156] | |||
20 | WAY-100635 | Drug Info | [159], [160], [161], [162] | |||
21 | (R)-flurocarazolol | Drug Info | [167] | |||
22 | (S)-flurocarazolol | Drug Info | [167] | |||
23 | cyamemazine | Drug Info | [199] | |||
24 | GR 125,743 | Drug Info | [194] | |||
25 | LY433221 | Drug Info | [207] | |||
26 | MPDT | Drug Info | [200] | |||
27 | P-MPPI | Drug Info | [209], [156] | |||
28 | p-[18F]MPPF | Drug Info | [210] | |||
29 | repinotan | Drug Info | [215] | |||
30 | SB 272183 | Drug Info | [216] | |||
31 | SB 649915 | Drug Info | [217] | |||
32 | SB 714786 | Drug Info | [217] | |||
33 | [11C]WAY100635 | Drug Info | [226] | |||
34 | [3H]robalzotan | Drug Info | [229] | |||
Ligand | [+] 3 Ligand drugs | + | ||||
1 | Aryl piperazine derivative 1 | Drug Info | [50] | |||
2 | PMID30124346-Compound-34TABLE4 | Drug Info | [50] | |||
3 | PMID30124346-Compound-60TABLE5 | Drug Info | [50] | |||
Binder | [+] 1 Binder drugs | + | ||||
1 | BTS-79018 | Drug Info | [35] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Biological Network Descriptors
of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.
The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information
(Front Pharmacol, 9, 1245, 2018;
Curr Opin Struct Biol. 44:134-142, 2017).
Human Similarity Proteins
Human Pathway Affiliation
Biological Network Descriptors
|
KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
---|---|---|---|
cAMP signaling pathway | hsa04024 | Affiliated Target |
|
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Neuroactive ligand-receptor interaction | hsa04080 | Affiliated Target |
|
Class: Environmental Information Processing => Signaling molecules and interaction | Pathway Hierarchy | ||
Serotonergic synapse | hsa04726 | Affiliated Target |
|
Class: Organismal Systems => Nervous system | Pathway Hierarchy | ||
Taste transduction | hsa04742 | Affiliated Target |
|
Class: Organismal Systems => Sensory system | Pathway Hierarchy |
Degree | 2 | Degree centrality | 2.15E-04 | Betweenness centrality | 6.17E-05 |
---|---|---|---|---|---|
Closeness centrality | 1.92E-01 | Radiality | 1.33E+01 | Clustering coefficient | 0.00E+00 |
Neighborhood connectivity | 1.70E+01 | Topological coefficient | 5.00E-01 | Eccentricity | 13 |
Download | Click to Download the Full PPI Network of This Target | ||||
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating Transcription Factors |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 3 KEGG Pathways | + | ||||
1 | cAMP signaling pathway | |||||
2 | Neuroactive ligand-receptor interaction | |||||
3 | Serotonergic synapse | |||||
Panther Pathway | [+] 2 Panther Pathways | + | ||||
1 | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | |||||
2 | 5HT1 type receptor mediated signaling pathway | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | Serotonin receptors | |||||
2 | G alpha (i) signalling events | |||||
WikiPathways | [+] 6 WikiPathways | + | ||||
1 | Serotonin HTR1 Group and FOS Pathway | |||||
2 | SIDS Susceptibility Pathways | |||||
3 | Monoamine GPCRs | |||||
4 | GPCRs, Class A Rhodopsin-like | |||||
5 | GPCR ligand binding | |||||
6 | GPCR downstream signaling |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation | ||||||
Target QSAR Model |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Interactions between corticotropin-releasing hormone and serotonin: implications for the aetiology and treatment of anxiety disorders. Handb Exp Pharmacol. 2005;(169):181-204. | |||||
REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 36). | |||||
REF 3 | Glutamate and anxiety disorders. Curr Psychiatry Rep. 2007 Aug;9(4):278-83. | |||||
REF 4 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7427). | |||||
REF 5 | 2011 FDA drug approvals. Nat Rev Drug Discov. 2012 Feb 1;11(2):91-4. | |||||
REF 6 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8182). | |||||
REF 7 | Radium 223 dichloride for prostate cancer treatment. Drug Des Devel Ther. 2017 Sep 6;11:2643-2651. | |||||
REF 8 | FDA Approved Drug Products from FDA Official Website. 2023. Application Number: 021164 | |||||
REF 9 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7672). | |||||
REF 10 | ClinicalTrials.gov (NCT01397786) Safety and Tolerability Study of Oral OPC-34712 as Maintenance Treatment in Adults With Schizophrenia. U.S. National Institutes of Health. | |||||
REF 11 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 64). | |||||
REF 12 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 13 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 213). | |||||
REF 14 | Emerging treatments for depression. Expert Opin Pharmacother. 2006 Dec;7(17):2323-39. | |||||
REF 15 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 021926. | |||||
REF 16 | Pharmaceutical Research Companies Are Developing More Than 300 Medicines to Treat Mental Illnesses. Pharmaceutical Research and Manufacturers of America report.2010. | |||||
REF 17 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 18 | ClinicalTrials.gov (NCT04109950) A Clinical Study to Evaluate the Long-term Safety and Tolerability of an Investigational Drug in People With Schizophrenia. U.S. National Institutes of Health. | |||||
REF 19 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 20 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 21 | ClinicalTrials.gov (NCT00277810) Study Evaluating the Safety, Tolerability, and Efficacy of Lecozotan SR in Outpatients With Alzheimer's Disease. U.S. National Institutes of Health. | |||||
REF 22 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800037483) | |||||
REF 23 | Ensaculin (KA-672 HCl): a multitransmitter approach to dementia treatment. CNS Drug Rev. 2002 Summer;8(2):143-58. | |||||
REF 24 | Orally active benzamide antipsychotic agents with affinity for dopamine D2, serotonin 5-HT1A, and adrenergic alpha1 receptors. J Med Chem. 1998 Jun 4;41(12):1997-2009. | |||||
REF 25 | Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. | |||||
REF 26 | ClinicalTrials.gov (NCT01489969) Sleep Laboratory Study to Investigate the Safety and Efficacy of Neu-P11 in Primary Insomnia Patients. U.S. National Institutes of Health. | |||||
REF 27 | Designing drugs for the treatment of female sexual dysfunction. Drug Discov Today. 2007 Sep;12(17-18):757-66. | |||||
REF 28 | ClinicalTrials.gov (NCT00000189) Gepirone vs Placebo in Treatment of Cocaine Dependence - 3. U.S. National Institutes of Health. | |||||
REF 29 | ClinicalTrials.gov (NCT01490086) RP5063 in Subjects With Schizophrenia or Schizoaffective Disorder. U.S. National Institutes of Health. | |||||
REF 30 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 26). | |||||
REF 31 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002186) | |||||
REF 32 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 167). | |||||
REF 33 | S 16924 ((R)-2-[1-[2-(2,3-dihydro-benzo[1,4] dioxin-5-Yloxy)-ethyl]-pyrrolidin-3yl]-1-(4-fluoro-phenyl)-ethanone), a novel, potential antipsychotic with marked serotonin (5-HT)1A agonist properties: I. Receptorial and neurochemical profile in comparison with clozapine and haloperidol. J Pharmacol Exp Ther. 1998 Sep;286(3):1341-55. | |||||
REF 34 | S-16924 [(R)-2-[1-[2-(2,3-dihydro-benzo[1,4]dioxin-5-yloxy)-ethyl]- pyrrolidin-3yl]-1-(4-fluorophenyl)-ethanone], a novel, potential antipsychotic with marked serotonin1A agonist properties: III. Anxiolytic actions in comparison with clozapine and haloperidol. J Pharmacol Exp Ther. 1999 Mar;288(3):1002-14. | |||||
REF 35 | The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. | |||||
REF 36 | Positron emission tomographic analysis of central dopamine D1 receptor binding in normal subjects treated with the atypical neuroleptic, SDZ MAR 327. Int J Mol Med. 1998 Jan;1(1):243-7. | |||||
REF 37 | ClinicalTrials.gov (NCT00272909) Efficacy of SUN N4057 in Subjects With Acute Ischemic Stroke and Measurable Penumbra on Magnetic Resonance Imaging (MRI). U.S. National Institutes of Health. | |||||
REF 38 | Clinical pipeline report, company report or official report of Fabre-Kramer Pharmaceuticals. | |||||
REF 39 | Clinical pipeline report, company report or official report of Fabre-Kramer Pharmaceuticals. | |||||
REF 40 | Clinical pipeline report, company report or official report of Fabre-Kramer Pharmaceuticals. | |||||
REF 41 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 58). | |||||
REF 42 | The serotonin 5-HT receptor agonist tandospirone improves executive function in common marmosets. Behav Brain Res. 2015 Jul 1;287:120-6. | |||||
REF 43 | ClinicalTrials.gov (NCT01774747) A Multiple Ascending Oral Dose Evaluation of the Safety, Tolerability, and Pharmacokinetics of DSP-1053 and Its Metabolites in Healthy Subjects and in Subjects With Major Depressive Disorder. U.S. National Institutes of Health. | |||||
REF 44 | 1192U90 in animal tests that predict antipsychotic efficacy, anxiolysis, and extrapyramidal side effects. Neuropsychopharmacology. 1996 Sep;15(3):231-42. | |||||
REF 45 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025412) | |||||
REF 46 | ClinicalTrials.gov (NCT00664365) FTIH Study With GSK958108. U.S. National Institutes of Health. | |||||
REF 47 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 48 | Clinical pipeline report, company report or official report of SK Biopharmaceuticals. | |||||
REF 49 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000698) | |||||
REF 50 | 5-HT1A receptor ligands and their therapeutic applications: review of new patents.Expert Opin Ther Pat. 2018 Sep;28(9):679-689. | |||||
REF 51 | mGlu5 negative allosteric modulators: a patent review (2013 - 2016).Expert Opin Ther Pat. 2017 Jun;27(6):691-706. | |||||
REF 52 | Caspase inhibitors: a review of recently patented compounds (2013-2015).Expert Opin Ther Pat. 2018 Jan;28(1):47-59. | |||||
REF 53 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 17). | |||||
REF 54 | Psychopathology and psychophysiology of minimal LSD-25 dosage; a preliminary dosage-response spectrum. AMA Arch Neurol Psychiatry. 1958 Feb;79(2):208-10. | |||||
REF 55 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8). | |||||
REF 56 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000679) | |||||
REF 57 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1). | |||||
REF 58 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001126) | |||||
REF 59 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014469) | |||||
REF 60 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001421) | |||||
REF 61 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004776) | |||||
REF 62 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026154) | |||||
REF 63 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001441) | |||||
REF 64 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 74). | |||||
REF 65 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010455) | |||||
REF 66 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 72). | |||||
REF 67 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006370) | |||||
REF 68 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000677) | |||||
REF 69 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001422) | |||||
REF 70 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013610) | |||||
REF 71 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006909) | |||||
REF 72 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010848) | |||||
REF 73 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003531) | |||||
REF 74 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001415) | |||||
REF 75 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001433) | |||||
REF 76 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002172) | |||||
REF 77 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800029346) | |||||
REF 78 | Pharmacokinetics, Pharmacodynamics and Tolerance of SLV 307 After Single Oral Administration in Healthy Male Volunteers. Clinical Pharmacology & Therapeutics. 02/1999; 65(2). | |||||
REF 79 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002258) | |||||
REF 80 | Effects of anpirtoline on regional serotonin synthesis in the rat brain: an autoradiographic study. Nucl Med Biol. 2006 Apr;33(3):325-32. | |||||
REF 81 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001927) | |||||
REF 82 | Neither in vivo MRI nor behavioural assessment indicate therapeutic efficacy for a novel 5HT1A agonist in rat models of ischaemic stroke. BMC Neuroscience 2009, 10:82. | |||||
REF 83 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003558) | |||||
REF 84 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 42). | |||||
REF 85 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000695) | |||||
REF 86 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 19). | |||||
REF 87 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003567) | |||||
REF 88 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001430) | |||||
REF 89 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 24). | |||||
REF 90 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001368) | |||||
REF 91 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 80). | |||||
REF 92 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002783) | |||||
REF 93 | Effects of brexpiprazole, a novel serotonin-dopamine activity modulator, on phencyclidine-induced cognitive deficits in mice: a role for serotonin 5-HT1A receptors.Pharmacol Biochem Behav.2014 Sep;124:245-9. | |||||
REF 94 | Brexpiprazole: First Global Approval.Drugs.2015 Sep;75(14):1687-97. | |||||
REF 95 | Synthesis of new derivatives of 8-OH-DPAT: Influence of substitution on the aromatic ring on the pharmacological profile, Bioorg. Med. Chem. Lett. 3(10):2035-2038 (1993). | |||||
REF 96 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | |||||
REF 97 | Clinical pipeline report, company report or official report of GlaxoSmithKline (2009). | |||||
REF 98 | Urapidil. A reappraisal of its use in the management of hypertension. Drugs. 1998 Nov;56(5):929-55. | |||||
REF 99 | Clinical pipeline report, company report or official report of Jazz Pharmaceuticals. | |||||
REF 100 | Pharma & Vaccines. Product Development Pipeline. April 29 2009. | |||||
REF 101 | A positron emission tomography study to assess binding of lecozotan, a novel 5-hydroxytryptamine-1A silent antagonist, to brain 5-HT1A receptors in... Clin Pharmacol Ther. 2008 Jan;83(1):86-96. | |||||
REF 102 | The discriminative stimulus effects of KA 672, a putative cognitive enhancer: evidence for a 5-HT1A component. Pharmacol Biochem Behav. 1998 Jul;60(3):703-7. | |||||
REF 103 | Dual ligands targeting dopamine D2 and serotonin 5-HT1A receptors as new antipsychotical or anti-Parkinsonian agents.Curr Med Chem.2014;21(4):437-57. | |||||
REF 104 | Clinical pipeline report, company report or official report of Neurim Pharmaceuticals. | |||||
REF 105 | Antidepressant-like responses to the combined sigma and 5-HT1A receptor agonist OPC-14523. Neuropharmacology. 2001 Dec;41(8):976-88. | |||||
REF 106 | Antagonism of the 5-HT1A receptor stimulus in a conditioned taste aversion procedure. Eur Neuropsychopharmacol. 1999 Jun;9(4):345-9. | |||||
REF 107 | Drug Development in Schizophrenia: Summary and Table. Pharmaceutical Medicine October 2014, Volume 28, Issue 5, pp 265-271 | |||||
REF 108 | EFFICACY AND SAFETY OF NOVEL DOPAMINE SEROTONIN STABILIZER RP 5063 IN ACUTE SCHIZOPHRENIA AND SCHIZOAFFECTIVE DISORDER. Schizophrenia Research Volume 153, Supplement 1, April 2014, Pages S22. | |||||
REF 109 | S 15535, a benzodioxopiperazine acting as presynaptic agonist and postsynaptic 5-HT1A receptor antagonist, prevents the impairment of spatial learning caused by intrahippocampal scopolamine. Br J Pharmacol. 1999 Nov;128(6):1207-14. | |||||
REF 110 | Labelling of recombinant human and native rat serotonin 5-HT1A receptors by a novel, selective radioligand, [3H]-S 15535: definition of its binding profile using agonists, antagonists and inverse agonists. Naunyn Schmiedebergs Arch Pharmacol. 1998 Mar;357(3):205-17. | |||||
REF 111 | DOI: 10.1038/sj.mp.4002062 | |||||
REF 112 | Experimental study of pharmacological hypothermia: enhanced neuroprotective effect of a novel 5-HT 1 A agonist SUN N4057 by the pharmacological hypothermia. No To Shinkei. 2001 Sep;53(9):853-8. | |||||
REF 113 | Company report (Fabrekramer) | |||||
REF 114 | 50 years of hurdles and hope in anxiolytic drug discovery. Nat Rev Drug Discov. 2013 Sep;12(9):667-87. | |||||
REF 115 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032503) | |||||
REF 116 | Clinical pipeline report, company report or official report of Fabre-Kramer Pharmaceuticals. | |||||
REF 117 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025412) | |||||
REF 118 | Clinical pipeline report, company report or official report of GlaxoSmithKline. | |||||
REF 119 | In vivo electrophysiological and neurochemical effects of the selective 5-HT1A receptor agonist, F13640, at pre- and postsynaptic 5-HT1A receptors in the rat.Psychopharmacology (Berl).2012 May;221(2):261-72. | |||||
REF 120 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1). | |||||
REF 121 | SSR181507, a dopamine D receptor and 5-HT() receptor ligand: evidence for mixed anxiolytic- and antidepressant-like activities.Pharmacol Biochem Behav.2011 Jan;97(3):428-35. | |||||
REF 122 | The effects of umespirone as a potential anxiolytic and antipsychotic agent. Pharmacol Biochem Behav. 1991 Sep;40(1):89-96. | |||||
REF 123 | Stereoselective LSD-like activity in a series of d-lysergic acid amides of (R)- and (S)-2-aminoalkanes. J Med Chem. 1995 Mar 17;38(6):958-66. | |||||
REF 124 | Bifeprunox: a partial agonist at dopamine D2 and serotonin 1A receptors, influences nicotine-seeking behaviour in response to drug-associated stimuli in rats.Addict Biol.2012 Mar;17(2):274-86. | |||||
REF 125 | BMY 14802, a sigma receptor ligand for the treatment of schizophrenia. Neuropsychopharmacology. 1994 Feb;10(1):37-40. | |||||
REF 126 | The effects of BMY-14802 against L-DOPA- and dopamine agonist-induced dyskinesia in the hemiparkinsonian rat | |||||
REF 127 | Effect of sustained administration of the 5-HT1A receptor agonist flesinoxan on rat 5-HT neurotransmission. Eur Neuropsychopharmacol. 1999 Sep;9(5):427-40. | |||||
REF 128 | An integrated in silico 3D model-driven discovery of a novel, potent, and selective amidosulfonamide 5-HT1A agonist (PRX-00023) for the treatment o... J Med Chem. 2006 Jun 1;49(11):3116-35. | |||||
REF 129 | Synthesis and biological activity of the putative metabolites of the atypical antipsychotic agent tiospirone. J Med Chem. 1991 Nov;34(11):3316-28. | |||||
REF 130 | Chronic alnespirone-induced desensitization of somatodendritic 5-HT1A autoreceptors in the rat dorsal raphe nucleus. Eur J Pharmacol. 1999 Jan 22;365(2-3):165-73. | |||||
REF 131 | The effects of AP521, a novel anxiolytic drug, in three anxiety models and on serotonergic neural transmission in rats. J Pharmacol Sci. 2015 Jan;127(1):109-16. | |||||
REF 132 | Effect of acute administration of the 5-HT1A receptor ligand, lesopitron, on rat cortical 5-HT and dopamine turnover. Br J Pharmacol. 1994 Oct;113(2):425-30. | |||||
REF 133 | A new arylpiperazine antipsychotic with high D2/D3/5-HT1A/alpha 1A-adrenergic affinity and a low potential for extrapyramidal effects. J Med Chem. 1994 Apr 15;37(8):1060-2. | |||||
REF 134 | PRX-00023, a selective serotonin 1A receptor agonist, reduces ultrasonic vocalizations in infant rats bred for high infantile anxiety.Pharmacol Biochem Behav.2009 Nov;94(1):8-15. | |||||
REF 135 | N-[2-[4-(2-methoxyphenyl)-1-piperazinyl]ethyl]-N-(2-nitrophenyl) cyclohexanecarboxamide: a novel pre- and postsynaptic 5-hydroxytryptamine(1A) receptor antagonist active on the lower urinary tract. JPharmacol Exp Ther. 2001 Dec;299(3):1027-37. | |||||
REF 136 | Use of PET and the radioligand [carbonyl-(11)C]WAY-100635 in psychotropic drug development. Nucl Med Biol. 2000 Jul;27(5):515-21. | |||||
REF 137 | Quantifying the 5-HT1A agonist action of buspirone in man. Psychopharmacology (Berl). 2001 Nov;158(3):224-9. | |||||
REF 138 | A comparison of the neuro-endocrinological and temperature effects of DU 29894, flesinoxan, sulpiride and haloperidol in normal volunteers. Br J Clin Pharmacol. 1995 Jan;39(1):7-14. | |||||
REF 139 | In vitro interactions between a potential muscle relaxant E2101 and human cytochromes P450. Drug Metab Dispos. 2002 Jul;30(7):805-13. | |||||
REF 140 | The pharmacological profile of (R)-3,4-dihydro-N-isopropyl-3-(N-isopropyl-N-propylamino)-2H-1-benzopyran-5-carboxamide, a selective 5-hydroxytryptamine(1A) receptor agonist. J Pharmacol Exp Ther. 2001 Dec;299(3):883-93. | |||||
REF 141 | The use of sleep measures to compare a new 5HT1A agonist with buspirone in humans. J Psychopharmacol. 2005 Nov;19(6):609-13. | |||||
REF 142 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003531) | |||||
REF 143 | Simultaneous determination of nerisopam, a novel anxiolytic agent showing polymorphic metabolism, and its N-acetyl metabolite from human plasma by a validated high performance liquid chromatographic method. J Chromatogr B Biomed Appl. 1996 Mar 29;678(1):63-72. | |||||
REF 144 | Synthesis and dual D2 and 5-HT1A receptor binding affinities of 7-piperazinyl and 7-piperidinyl-3,4-dihydroquinazolin-2(1H)-ones. Med Chem. 2014;10(5):484-96. | |||||
REF 145 | Effects of SUN 8399, a potent and selective 5-HT1A agonist, on conflict behavior and ambulatory activity in mice: comparison with those of buspirone, tandospirone and diazepam. Jpn J Pharmacol. 1994 Apr;64(4):273-80. | |||||
REF 146 | Tolerance development to the vagal-mediated bradycardia produced by 5-HT1A receptor agonists. J Pharmacol Exp Ther. 1994 Nov;271(2):776-81. | |||||
REF 147 | CN patent application no. 104151292, Indole derivative or a pharmaceutically acceptable salt thereof. | |||||
REF 148 | Cardiovascular activity of A-74283, a 5-hydroxytryptamine 1A agent, in the spontaneously hypertensive rat. Pharmacology. 1998 Jan;56(1):17-29. | |||||
REF 149 | Designed multiple ligands. An emerging drug discovery paradigm. J Med Chem. 2005 Oct 20;48(21):6523-43. | |||||
REF 150 | 8-[4-[2-(1,2,3,4-Tetrahydroisoquinolinyl]butyl-8-azaspiro[4.5]decane-7,9-dione: a new 5-HT1A receptor ligand with the same activity profile as busp... J Med Chem. 1996 Mar 1;39(5):1125-9. | |||||
REF 151 | Quantitative determination of CGS 18102A, a new anxiolytic, in human plasma using capillary gas chromatography/mass spectrometry. Biomed Chromatogr. 1992 Sep-Oct;6(5):244-7. | |||||
REF 152 | Neither in vivo MRI nor behavioural assessment indicate therapeutic efficacy for a novel 5HT1A agonist in rat models of ischaemic stroke. BMC Neuroscience 2009, 10:82. | |||||
REF 153 | Pharmacological profile of (-)HT-90B, a novel 5-HT1A receptor agonist/5-HT2 receptor antagonist. Prog Neuropsychopharmacol Biol Psychiatry. 1995 Nov;19(7):1201-16. | |||||
REF 154 | Chronic voluntary ethanol intake hypersensitizes 5-HT(1A) autoreceptors in C57BL/6J mice. J Neurochem. 2008 Dec;107(6):1660-70. | |||||
REF 155 | Pharmacological characterization of LY293284: A 5-HT1A receptor agonist with high potency and selectivity. J Pharmacol Exp Ther. 1994 Sep;270(3):1270-81. | |||||
REF 156 | Influence of 5-HT1A receptor antagonism on plus-maze behaviour in mice. II. WAY 100635, SDZ 216-525 and NAN-190. Pharmacol Biochem Behav. 1997 Oct;58(2):593-603. | |||||
REF 157 | Piperazinylalkyl heterocycles as potential antipsychotic agents. J Med Chem. 1995 Oct 13;38(21):4198-210. | |||||
REF 158 | S 14506: novel receptor coupling at 5-HT(1A) receptors. Neuropharmacology. 2001 Mar;40(3):334-44. | |||||
REF 159 | Pharmacological characterization of recombinant human 5-hydroxytryptamine1A receptors using a novel antagonist radioligand, [3H]WAY-100635. Life Sci. 1997;60(9):653-65. | |||||
REF 160 | 5-Hydroxytryptamine1A receptor occupancy by novel full antagonist 2-[4-[4-(7-chloro-2,3-dihydro-1,4-benzdioxyn-5-yl)-1-piperazinyl]butyl]-1,2-benzisothiazol-3-(2H)-one-1,1-dioxide: a[11C][O-methyl-3H]-N-(2-(4-(2-methoxyphenyl)-1-piperazinyl)ethyl)-N-(2-pyridinyl)cyclohexanecarboxamide trihydrochloride (WAY-100635) positron emission tomography study in humans. J Pharmacol Exp Ther. 2002 Jun;301(3):1144-50. | |||||
REF 161 | Cocaine and serotonin: a role for the 5-HT(1A) receptor site in the mediation of cocaine stimulant effects. Behav Brain Res. 2001 Nov 29;126(1-2):127-33. | |||||
REF 162 | Involvement of 5-hydroxytryptamine(1A) receptors in nicotine-induced tail tremor in rats. Eur J Pharmacol. 2000 Nov 10;408(1):19-23. | |||||
REF 163 | Synthesis of (R,S)-trans-8-hydroxy-2-[N-n-propyl-N-(3'-iodo-2'-propenyl)amino]tetral in (trans-8-OH-PIPAT): a new 5-HT1A receptor ligand. J Med Chem. 1993 Oct 15;36(21):3161-5. | |||||
REF 164 | Synthesis and evaluation of phenyl- and benzoylpiperazines as potential serotonergic agents. J Med Chem. 1986 May;29(5):630-4. | |||||
REF 165 | R-(-)-N-alkyl-11-hydroxy-10-hydroxymethyl- and 10-methyl-aporphines as 5-HT1A receptor ligands. Bioorg Med Chem Lett. 2007 Aug 1;17(15):4128-30. | |||||
REF 166 | Synthesis and pharmacological investigation of novel 2-aminothiazole-privileged aporphines. Bioorg Med Chem. 2008 Jul 15;16(14):6675-81. | |||||
REF 167 | The in vitro pharmacology of the beta-adrenergic receptor pet ligand (s)-fluorocarazolol reveals high affinity for cloned beta-adrenergic receptors and moderate affinity for the human 5-HT1A receptor. Psychopharmacology (Berl). 2001 Aug;157(1):111-4. | |||||
REF 168 | 5-HT1 and 5-HT2 binding characteristics of some quipazine analogues. J Med Chem. 1986 Nov;29(11):2375-80. | |||||
REF 169 | Discovery of bishomo(hetero)arylpiperazines as novel multifunctional ligands targeting dopamine D(3) and serotonin 5-HT(1A) and 5-HT(2A) receptors. J Med Chem. 2010 Jun 24;53(12):4803-7. | |||||
REF 170 | 1-((S)-2-aminopropyl)-1H-indazol-6-ol: a potent peripherally acting 5-HT2 receptor agonist with ocular hypotensive activity. J Med Chem. 2006 Jan 12;49(1):318-28. | |||||
REF 171 | 5-HT1 and 5-HT2 binding characteristics of 1-(2,5-dimethoxy-4-bromophenyl)-2-aminopropane analogues. J Med Chem. 1986 Feb;29(2):194-9. | |||||
REF 172 | Discovery and pharmacological characterization of aryl piperazine and piperidine ethers as dual acting norepinephrine reuptake inhibitors and 5-HT1... Bioorg Med Chem Lett. 2009 Dec 1;19(23):6604-7. | |||||
REF 173 | Activity of aromatic substituted phenylpiperazines lacking affinity for dopamine binding sites in a preclinical test of antipsychotic efficacy. J Med Chem. 1989 May;32(5):1052-6. | |||||
REF 174 | Pyrimido[5,4-b]indole derivatives. 1. A new class of potent and selective alpha 1 adrenoceptor ligands. J Med Chem. 1991 Jun;34(6):1850-4. | |||||
REF 175 | Structure-activity relationship studies of central nervous system agents. 13. 4-[3-(Benzotriazol-1-yl)propyl]-1-(2-methoxyphenyl)piperazine, a new ... J Med Chem. 1994 Aug 19;37(17):2754-60. | |||||
REF 176 | Identification of a red-emitting fluorescent ligand for in vitro visualization of human serotonin 5-HT(1A) receptors. Bioorg Med Chem Lett. 2010 Nov 15;20(22):6628-32. | |||||
REF 177 | The synthesis and biological activity of pentafluorosulfanyl analogs of fluoxetine, fenfluramine, and norfenfluramine. Bioorg Med Chem. 2007 Nov 1;15(21):6659-66. | |||||
REF 178 | 5-HT1B receptor antagonist properties of novel arylpiperazide derivatives of 1-naphthylpiperazine. J Med Chem. 1997 Nov 21;40(24):3974-8. | |||||
REF 179 | Arylmethyloxyphenyl derivatives: small molecules displaying P-glycoprotein inhibition. J Med Chem. 2006 Nov 2;49(22):6607-13. | |||||
REF 180 | Synthesis and structure-activity relationships of 1-aralkyl-4-benzylpiperidine and 1-aralkyl-4-benzylpiperazine derivatives as potent sigma ligands. J Med Chem. 2005 Jan 13;48(1):266-73. | |||||
REF 181 | Influence of the terminal amide fragment geometry in some 3-arylideneindolin-2(1H)-ones on their 5-HT1A/5-HT2A receptor activity. Bioorg Med Chem Lett. 2001 May 7;11(9):1229-31. | |||||
REF 182 | Regioselective synthesis of 3-aryl substituted pyrrolidines via palladium catalyzed arylation: pharmacological evaluation for central dopaminergic and serotonergic activity, Bioorg. Med. Chem. Lett. 7(3):241-246 (1997). | |||||
REF 183 | Novel aminoethylbiphenyls as 5-HT7 receptor ligands. Bioorg Med Chem Lett. 2007 Jun 1;17(11):3018-22. | |||||
REF 184 | Design, synthesis, and pharmacological evaluation of phenoxy pyridyl derivatives as dual norepinephrine reuptake inhibitors and 5-HT1A partial agon... Bioorg Med Chem Lett. 2010 Feb 1;20(3):1114-7. | |||||
REF 185 | SAR studies on new bis-aryls 5-HT7 ligands: Synthesis and molecular modeling. Bioorg Med Chem. 2010 Mar 1;18(5):1958-67. | |||||
REF 186 | 4-(3-furyl)-2-(4-methylpiperazino)pyrimidines: Potent 5-HT2A receptor antagonists, Bioorg. Med. Chem. Lett. 7(13):1635-1638 (1997). | |||||
REF 187 | A novel and selective 5-HT2 receptor agonist with ocular hypotensive activity: (S)-(+)-1-(2-aminopropyl)-8,9-dihydropyrano[3,2-e]indole. J Med Chem. 2003 Sep 11;46(19):4188-95. | |||||
REF 188 | 3-(1,2,5,6-Tetrahydropyrid-4-yl)pyrrolo[3,2-b]pyrid-5-one: a potent and selective serotonin (5-HT1B) agonist and rotationally restricted phenolic a... J Med Chem. 1990 Aug;33(8):2087-93. | |||||
REF 189 | New generation dopaminergic agents. 2. Discovery of 3-OH-phenoxyethylamine and 3-OH-N1-phenylpiperazine dopaminergic templates. Bioorg Med Chem Lett. 1998 Feb 3;8(3):295-300. | |||||
REF 190 | 6-Hydroxy-3-n-propyl-2,3,4,5-tetrahydro-1H-3-benzazepine and analogs: new centrally acting 5-HT1A receptor agonists. J Med Chem. 1992 Oct 30;35(22):3984-90. | |||||
REF 191 | Indoloxypropanolamine analogues as 5-HT(1A) receptor antagonists. Bioorg Med Chem Lett. 2007 Oct 15;17(20):5600-4. | |||||
REF 192 | Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97. | |||||
REF 193 | Cyclic guanidines as dual 5-HT5A/5-HT7 receptor ligands: structure-activity relationship elucidation. Bioorg Med Chem Lett. 2008 Jan 1;18(1):256-61. | |||||
REF 194 | Agonist activity of antimigraine drugs at recombinant human 5-HT1A receptors: potential implications for prophylactic and acute therapy. Naunyn Schmiedebergs Arch Pharmacol. 1997 Jun;355(6):682-8. | |||||
REF 195 | cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain... J Med Chem. 2008 Nov 27;51(22):7094-8. | |||||
REF 196 | Ergolines as selective 5-HT1 agonists. J Med Chem. 1988 Aug;31(8):1512-9. | |||||
REF 197 | SB-216641 and BRL-15572--compounds to pharmacologically discriminate h5-HT1B and h5-HT1D receptors. Naunyn Schmiedebergs Arch Pharmacol. 1997 Sep;356(3):312-20. | |||||
REF 198 | WO patent application no. 2012,0025,83, Method for treating schizophrenia and related diseases with a combination therapy. | |||||
REF 199 | Affinity of cyamemazine, an anxiolytic antipsychotic drug, for human recombinant dopamine vs. serotonin receptor subtypes. Biochem Pharmacol. 2003 Feb 1;65(3):435-40. | |||||
REF 200 | 2-Substituted tryptamines: agents with selectivity for 5-HT(6) serotonin receptors. J Med Chem. 2000 Mar 9;43(5):1011-8. | |||||
REF 201 | Diagnosis of migraine with aura, depression and anxiety from allelic variations in dopaminergic genes | |||||
REF 202 | Alkaloids from Eschscholzia californica and their capacity to inhibit binding of [3H]8-Hydroxy-2-(di-N-propylamino)tetralin to 5-HT1A receptors in ... J Nat Prod. 2006 Mar;69(3):432-5. | |||||
REF 203 | Agonist and antagonist actions of antipsychotic agents at 5-HT1A receptors: a [35S]GTPgammaS binding study. Eur J Pharmacol. 1998 Aug 21;355(2-3):245-56. | |||||
REF 204 | Identification of a potent, selective, and orally active leukotriene a4 hydrolase inhibitor with anti-inflammatory activity. J Med Chem. 2008 Jul 24;51(14):4150-69. | |||||
REF 205 | 3-[3-(Piperidin-1-yl)propyl]indoles as highly selective h5-HT(1D) receptor agonists. J Med Chem. 1999 Dec 2;42(24):4981-5001. | |||||
REF 206 | Structural modifications of N-(1,2,3,4-tetrahydronaphthalen-1-yl)-4-aryl-1-piperazinehexanamides: influence on lipophilicity and 5-HT7 receptor act... J Med Chem. 2008 Sep 25;51(18):5813-22. | |||||
REF 207 | Serotonin reuptake inhibitors: the corner stone in treatment of depression for half a century--a medicinal chemistry survey. Curr Top Med Chem. 2006;6(17):1801-23. | |||||
REF 208 | Arylpiperazine derivatives as high-affinity 5-HT1A serotonin ligands. J Med Chem. 1988 Oct;31(10):1968-71. | |||||
REF 209 | p-Chloroamphetamine, a serotonin-releasing drug, elicited in rats a hyperglycemia mediated by the 5-HT1A and 5-HT2B/2C receptors. Eur J Pharmacol. 1998 Oct 23;359(2-3):185-90. | |||||
REF 210 | A 18F-MPPF PET normative database of 5-HT1A receptor binding in men and women over aging. J Nucl Med. 2005 Dec;46(12):1980-9. | |||||
REF 211 | New sigma and 5-HT1A receptor ligands: omega-(tetralin-1-yl)-n-alkylamine derivatives. J Med Chem. 1996 Jan 5;39(1):176-82. | |||||
REF 212 | Heterocyclic analogues of N-(4-(4-(2,3-dichlorophenyl)piperazin-1-yl)butyl)arylcarboxamides with functionalized linking chains as novel dopamine D3... J Med Chem. 2007 Aug 23;50(17):4135-46. | |||||
REF 213 | Differential actions of antiparkinson agents at multiple classes of monoaminergic receptor. I. A multivariate analysis of the binding profiles of 14 drugs at 21 native and cloned human receptor subtypes. J Pharmacol Exp Ther. 2002 Nov;303(2):791-804. | |||||
REF 214 | Novel, potent, and selective quinoxaline-based 5-HT(3) receptor ligands. 1. Further structure-activity relationships and pharmacological characteri... J Med Chem. 2009 Nov 12;52(21):6946-50. | |||||
REF 215 | Characterization of the aminomethylchroman derivative BAY x 3702 as a highly potent 5-hydroxytryptamine1A receptor agonist. J Pharmacol Exp Ther. 1998 Mar;284(3):1082-94. | |||||
REF 216 | SB-272183, a selective 5-HT(1A), 5-HT(1B) and 5-HT(1D) receptor antagonist in native tissue. Br J Pharmacol. 2001 Jul;133(6):797-806. | |||||
REF 217 | Discovery of the first potent, selective 5-hydroxytryptamine1D receptor antagonist. J Med Chem. 2005 May 19;48(10):3478-80. | |||||
REF 218 | Discovery of 3-aryl-3-methyl-1H-quinoline-2,4-diones as a new class of selective 5-HT6 receptor antagonists. Bioorg Med Chem Lett. 2008 Jan 15;18(2):738-43. | |||||
REF 219 | Novel 3-aminochromans as potential pharmacological tools for the serotonin 5-HT(7) receptor. Bioorg Med Chem Lett. 2005 Feb 1;15(3):747-50. | |||||
REF 220 | Synthesis and structure-activity relationship of fluoro analogues of 8-{2-[4-(4-methoxyphenyl)piperazin-1yl]ethyl}-8-azaspiro[4.5]decane-7,9-dione ... J Med Chem. 2005 Apr 21;48(8):3076-9. | |||||
REF 221 | Effect of SR 59026A, a new 5-HT(1A) receptor agonist, on sexual activity in male rats. Behav Pharmacol. 1995 Apr;6(3):276-282. | |||||
REF 222 | Characterization of U-92016A as a selective, orally active, high intrinsic activity 5-hydroxytryptamine1A agonist. J Pharmacol Exp Ther. 1994 Nov;271(2):875-83. | |||||
REF 223 | (Dipropylamino)-tetrahydronaphthofurans: centrally acting serotonin agonists and dopamine agonists-antagonists, Bioorg. Med. Chem. Lett. 7(21):2759-2764 (1997). | |||||
REF 224 | N-[2-[(substituted chroman-8-yl)oxy]ethyl]-4-(4-methoxyphenyl)butylamines: synthesis and wide range of antagonism at the human 5-HT1A receptor. J Med Chem. 1997 Apr 11;40(8):1252-7. | |||||
REF 225 | Discovery of 5-arylsulfonamido-3-(pyrrolidin-2-ylmethyl)-1H-indole derivatives as potent, selective 5-HT6 receptor agonists and antagonists. J Med Chem. 2005 Jan 27;48(2):353-6. | |||||
REF 226 | [11C]-WAY100635 PET demonstrates marked 5-HT1A receptor changes in sporadic ALS. Brain. 2005 Apr;128(Pt 4):896-905. | |||||
REF 227 | Effect of ring fluorination on the pharmacology of hallucinogenic tryptamines. J Med Chem. 2000 Nov 30;43(24):4701-10. | |||||
REF 228 | [(3)H]-F13640, a novel, selective and high-efficacy serotonin 5-HT(1A) receptor agonist radioligand. Naunyn Schmiedebergs Arch Pharmacol. 2010 Oct;382(4):321-30. | |||||
REF 229 | Receptor binding characteristics of [3H]NAD-299, a new selective 5-HT1A receptor antagonist. Eur J Pharmacol. 1998 Nov 6;360(2-3):219-25. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.