Target Information

Target General Information

Top

Target ID

T79589 (Former ID: TTDR00304)

Target Name

Bacterial NADH-dependent enoyl-ACP reductase 2 (Bact fabI2)

Synonyms

NADH-dependent enoyl-ACP reductase 2; Enoyl-[acyl-carrier-protein] reductase [NADH] 2

Click to Show/Hide

Gene Name

Bact fabI2

Target Type

Literature-reported target

[1]

Function

Identified as the FabI protein, which is the target of a group of antibacterial compounds, the diazaborines.

Click to Show/Hide

BioChemical Class

CH-CH donor oxidoreductase

UniProt ID

FABI2_RHIME

Sequence

MNGLMNGKRGLIMGVANSHSIAWGIAKSLAAQGAELAFTYQGEALGKRVKPLAAEVNSDF
LLPCDVEDIGSVDAVVDAIKERWGKLDFVVHAIGFSDKNELKGLYADTTRDNFSRTMVIS
CFSFTEIAKRAAELMSEGGTMLTLTYGGSMRVMPNYNVMGVAKAALEASVRYLAADYGSR
GIRVNAISAGPIRTLAGAGISDARAMLSWQQKNSPLRRTVTIEDVGSSALYLLSDLSRGV
TGEIHYVDSGYNITSMPTLEALRVADAD

Click to Show/Hide

Different Human System Profiles of Target	Top
Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target. A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020). Human Similarity Proteins

Different Human System Profiles of Target

Top

Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.

A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020).

Human Similarity Proteins

Protein Name	Pfam ID	Percentage of Identity (%)	E value
15-hydroxyprostaglandin dehydrogenase [NAD(+)] (HPGD)	PF00106	23.000 (46/200)	7.07E-05
Dehydrogenase/reductase SDR family member 7 (DHRS7)	PF00106	22.449 (44/196)	5.00E-03

Target Affiliated Biological Pathways

Top

KEGG Pathway

[+] 4 KEGG Pathways

Fatty acid biosynthesis

Biotin metabolism

Metabolic pathways

Fatty acid metabolism

References

Top

REF 1

Lipid biosynthesis as a target for antibacterial agents. Prog Lipid Res. 2001 Nov;40(6):467-97.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Prof. Yuzong CHEN

Prof. Feng ZHU