Target Information

Target General Information

Top

Target ID

T82075 (Former ID: TTDR00969)

Target Name

Bacterial Celldivision protein FtsZ (Bact ftsZ)

Synonyms

FtsZprotein; FtsZ

Click to Show/Hide

Gene Name

Bact ftsZ

Target Type

Clinical trial target

[1]

Disease

[+] 1 Target-related Diseases

Infectious meningitis [ICD-11: 1D01]

Function

Essential cell division protein that forms a contractile ring structure (Z ring) at the future cell division site. The regulation of the ring assembly controls the timing and the location of cell division. One of the functions of the FtsZ ring is to recruit other cell division proteins to the septum to produce a new cell wall between the dividing cells. Binds GTP and shows GTPase activity.

Click to Show/Hide

BioChemical Class

Peptidase

UniProt ID

FTSZ_WOLSP

Sequence

MSIDLSLPELPILHPRITVVGVGGAGGNAVNNMIQSNLQGVNFVVANTDAQALEKSLCDK
KIQLGINLTKGLGAGALPDVGKGAAEESIDEIMEHIKDSHMLFITAGMGGGTGTGAAPVI
AKAAREARAAVKDRAPKEKKILTVGVVTKPFGFEGVRRMPIAELGLEELQKYVDTLIVIP
NQNLFRIANEKTTFSDAFKLADNVLHIGIRGVTDLMVMPGLINLDFADIETVMSEMGKAM
IGTGEAEGEDRAISAAEAAISNPLLDNVSMKGAQGILINITGGGDMTLFEVDAAANRVRE
EVDENANIIFGATFDQAMEGRVRVSVLATGIDGRNNKSETSPISQSEDSEKEKFKWPYSQ
SESTQDKTLETKPAEQVSEGAKWGSNIYDIPAYLRRKK

Click to Show/Hide

Different Human System Profiles of Target	Top
Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target. A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020). Human Similarity Proteins

Different Human System Profiles of Target

Top

Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.

A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020).

Human Similarity Proteins

There is no similarity protein (E value < 0.005) for this target

Drug Property Profile of Target

Top

(1) Molecular Weight (mw) based Drug Clustering

(2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering

(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering

(4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering

(5) Rotatable Bond Count (rotbonds) based Drug Clustering

(6) Topological Polar Surface Area (polararea) based Drug Clustering

"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five

References

Top

REF 1

How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.

REF 2

Clinical pipeline report, company report or official report of TAXIS Pharmaceuticals.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Prof. Yuzong CHEN

Prof. Feng ZHU