Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T82277
(Former ID: TTDNC00483)
|
|||||
| Target Name |
Cancer/testis antigen 1 (NY-ESO-1)
|
|||||
| Synonyms |
LAGE2B; LAGE2A; LAGE2; LAGE-2; L antigen family member 2; ESO1; Cancer/testis antigen 6.1; CTAG1B; CTAG1; CTAG; CT6.1; Autoimmunogenic cancer/testis antigen NYESO1; Autoimmunogenic cancer/testis antigen NY-ESO-1
Click to Show/Hide
|
|||||
| Gene Name |
CTAG1A
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 7 Target-related Diseases | + | ||||
| 1 | Ovarian cancer [ICD-11: 2C73] | |||||
| 2 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
| 3 | Esophageal cancer [ICD-11: 2B70] | |||||
| 4 | Lung cancer [ICD-11: 2C25] | |||||
| 5 | Multiple myeloma [ICD-11: 2A83] | |||||
| 6 | Synovial sarcoma [ICD-11: 2B5A] | |||||
| 7 | Melanoma [ICD-11: 2C30] | |||||
| Function |
Immunogenic protein. Its aberrant re-expression is induced by molecular mechanisms including: DNA demethylation, histone post-translational modification, and microRNA-mediated regulation. The effect of DNA demethylation is evident by the capability of demethylating agents, like 5-aza-2-deoxycytidine, to induce the re-expression of NY-ESO-1 in tumour cells but not in normal epithelial cells.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGA
PRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPG VLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 5 Clinical Trial Drugs | + | ||||
| 1 | CDX-1401 | Drug Info | Phase 2 | Solid tumour/cancer | [2] | |
| 2 | Anti-NY-ESO-1 CAR-T cells | Drug Info | Phase 1/2 | Esophageal cancer | [3] | |
| 3 | CV-9201 | Drug Info | Phase 1/2 | Non-small-cell lung cancer | [4] | |
| 4 | GSK-2241658A | Drug Info | Phase 1 | Melanoma | [6] | |
| 5 | NY-ESO-1 vaccine | Drug Info | Phase 1 | Solid tumour/cancer | [7] | |
| Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
| 1 | Melanoma vaccine (ALVAC) | Drug Info | Discontinued in Phase 2 | Melanoma | [8] | |
| Mode of Action | [+] 2 Modes of Action | + | ||||
| Modulator | [+] 1 Modulator drugs | + | ||||
| 1 | CDX-1401 | Drug Info | [1] | |||
| CAR-T-Cell-Therapy | [+] 1 CAR-T-Cell-Therapy drugs | + | ||||
| 1 | Anti-NY-ESO-1 CAR-T cells | Drug Info | [3] | |||
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
| Protein Name | Pfam ID | Percentage of Identity (%) | E value |
|---|---|---|---|
| Collagen alpha-5(VI) chain (COL6A5) | 31.461 (28/89) | 7.73E-04 |
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | National Cancer Institute Drug Dictionary (drug id 651880). | |||||
| REF 2 | ClinicalTrials.gov (NCT02129075) CDX-1401 and Poly-ICLC Vaccine Therapy With or Without CDX-301in Treating Patients With Stage IIB-IV Melanoma. U.S. National Institutes of Health. | |||||
| REF 3 | ClinicalTrials.gov (NCT03638206) Autologous CAR-T/TCR-T Cell Immunotherapy for Malignancies | |||||
| REF 4 | ClinicalTrials.gov (NCT00923312) Trial of an RNActive-Derived Cancer Vaccine in Stage IIIB/IV Non Small Cell Lung Cancer (NSCLC). U.S. National Institutes of Health. | |||||
| REF 5 | Clinical pipeline report, company report or official report of GlaxoSmithKline. | |||||
| REF 6 | ClinicalTrials.gov (NCT01213472) Evaluation of a New Anti-cancer Immunotherapy in Patients With Non-operable and Progressing Metastatic Cutaneous Melanoma. U.S. National Institutes of Health. | |||||
| REF 7 | ClinicalTrials.gov (NCT00199836) A Pilot Study of NY-ESO-1b Peptide Plus CpG 7909 and Montanide ISA-51 in Patients With Cancer.. U.S. National Institutes of Health. | |||||
| REF 8 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014153) | |||||
| REF 9 | National Cancer Institute Drug Dictionary (drug id 648549). | |||||
| REF 10 | Multiepitope CD8+ T cell response to a NY-ESO-1 peptide vaccine results in imprecise tumor targeting. J Clin Invest. 2002 December 15; 110(12): 1813-1822. | |||||
| REF 11 | Preclinical qualification of a new multi-antigen candidate vaccine for metastatic melanoma. J Immunother. 2010 Oct;33(8):743-58. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.