Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T83011
(Former ID: TTDS00341)
|
|||||
| Target Name |
Monoamine oxidase type B (MAO-B)
|
|||||
| Synonyms |
MAO-B; Amine oxidase [flavin-containing] B
Click to Show/Hide
|
|||||
| Gene Name |
MAOB
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 6 Target-related Diseases | + | ||||
| 1 | Dementia [ICD-11: 6D80-6D8Z] | |||||
| 2 | Depression [ICD-11: 6A70-6A7Z] | |||||
| 3 | Hypertension [ICD-11: BA00-BA04] | |||||
| 4 | Malaria [ICD-11: 1F40-1F45] | |||||
| 5 | Migraine [ICD-11: 8A80] | |||||
| 6 | Parkinsonism [ICD-11: 8A00] | |||||
| Function |
Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOB preferentially degrades benzylamine and phenylethylamine.
Click to Show/Hide
|
|||||
| BioChemical Class |
CH-NH(2) donor oxidoreductase
|
|||||
| UniProt ID | ||||||
| EC Number |
EC 1.4.3.4
|
|||||
| Sequence |
MSNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSY
VGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWR TMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEV SALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQ TRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVPLGSVIKCIVY YKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEER LKKLCELYAKVLGSLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVDR IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTT FLERHLPSVPGLLRLIGLTTIFSATALGFLAHKRGLLVRV Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
| HIT2.0 ID | T06Q1R | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 10 Approved Drugs | + | ||||
| 1 | Budipine | Drug Info | Approved | Migraine | [3] | |
| 2 | Indeloxazine | Drug Info | Approved | Dementia | [4] | |
| 3 | Pargyline | Drug Info | Approved | Hypertension | [4] | |
| 4 | Phenelzine | Drug Info | Approved | Depression | [4], [5], [6] | |
| 5 | Rasagiline | Drug Info | Approved | Parkinson disease | [7], [8] | |
| 6 | Safinamide | Drug Info | Approved | Parkinson disease | [9] | |
| 7 | Selegiline | Drug Info | Approved | Major depressive disorder | [10], [11] | |
| 8 | Selegiline Hydrochloride | Drug Info | Approved | Parkinson disease | [4] | |
| 9 | Sulphadoxine | Drug Info | Approved | Malaria | [12], [13] | |
| 10 | Tranylcypromine | Drug Info | Approved | Major depressive disorder | [4] | |
| Clinical Trial Drug(s) | [+] 7 Clinical Trial Drugs | + | ||||
| 1 | P2B-001 | Drug Info | Phase 3 | Parkinson disease | [14] | |
| 2 | CHF-3381 | Drug Info | Phase 2 | Neuropathic pain | [16], [17] | |
| 3 | EVT302 | Drug Info | Phase 2 | Alzheimer disease | [14], [18] | |
| 4 | Ladostigil | Drug Info | Phase 2 | Alzheimer disease | [19] | |
| 5 | RG1577 | Drug Info | Phase 2 | Alzheimer disease | [20] | |
| 6 | Neu-120 | Drug Info | Phase 1/2 | Parkinson disease | [21] | |
| 7 | PIPERINE | Drug Info | Phase 1/2 | Vitiligo | [22], [23] | |
| Patented Agent(s) | [+] 3 Patented Agents | + | ||||
| 1 | Lazabemide | Drug Info | Patented | Skin imperfections | [25] | |
| 2 | Schiff base compound 1 | Drug Info | Patented | Alzheimer disease | [26] | |
| 3 | Schiff base compound 2 | Drug Info | Patented | Alzheimer disease | [26] | |
| Discontinued Drug(s) | [+] 6 Discontinued Drugs | + | ||||
| 1 | MOFEGILINE | Drug Info | Discontinued in Phase 3 | Cognitive impairment | [27] | |
| 2 | AS602868 | Drug Info | Discontinued in Phase 1 | Multiple myeloma | [28] | |
| 3 | EVT-301 | Drug Info | Discontinued in Phase 1 | Alzheimer disease | [29] | |
| 4 | HT-1067 | Drug Info | Discontinued in Phase 1 | Parkinson disease | [30] | |
| 5 | SL-25.1188 | Drug Info | Discontinued in Phase 1 | Alzheimer disease | [31] | |
| 6 | Milacemide | Drug Info | Terminated | Alzheimer disease | [33] | |
| Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
| 1 | RWJ-416457 | Drug Info | Preclinical | Bacterial infection | [32] | |
| Mode of Action | [+] 3 Modes of Action | + | ||||
| Modulator | [+] 11 Modulator drugs | + | ||||
| 1 | Budipine | Drug Info | [3] | |||
| 2 | Indeloxazine | Drug Info | [4] | |||
| 3 | Selegiline Hydrochloride | Drug Info | [38], [40] | |||
| 4 | RG1577 | Drug Info | [46] | |||
| 5 | Neu-120 | Drug Info | [47] | |||
| 6 | Tetra-hydro-oxazolopyridine derivative 1 | Drug Info | [53] | |||
| 7 | Tetra-hydro-oxazolopyridine derivative 2 | Drug Info | [53] | |||
| 8 | MOFEGILINE | Drug Info | [54], [55] | |||
| 9 | Milacemide | Drug Info | [33] | |||
| 10 | 4-fluoroselegiline | Drug Info | [84] | |||
| 11 | LU-53439 | Drug Info | [95] | |||
| Inhibitor | [+] 283 Inhibitor drugs | + | ||||
| 1 | Pargyline | Drug Info | [34] | |||
| 2 | Phenelzine | Drug Info | [35] | |||
| 3 | Rasagiline | Drug Info | [36] | |||
| 4 | Safinamide | Drug Info | [37], [38] | |||
| 5 | Selegiline | Drug Info | [39] | |||
| 6 | Sulphadoxine | Drug Info | [41] | |||
| 7 | Tranylcypromine | Drug Info | [1], [42] | |||
| 8 | P2B-001 | Drug Info | [43] | |||
| 9 | Psoralen | Drug Info | [44] | |||
| 10 | TRYPTAMINE | Drug Info | [45] | |||
| 11 | CHF-3381 | Drug Info | [17] | |||
| 12 | EVT302 | Drug Info | [14], [18] | |||
| 13 | Ladostigil | Drug Info | [19] | |||
| 14 | PIPERINE | Drug Info | [48] | |||
| 15 | 3,4-Dihydroxybenzaldehyde | Drug Info | [25] | |||
| 16 | 3-Hydroxy-2-butanone | Drug Info | [25] | |||
| 17 | 4-Hydroxy-2,5-dimethyl-3(2H)-furanone | Drug Info | [25] | |||
| 18 | 4-hydroxybenzaldehyde | Drug Info | [25] | |||
| 19 | 4-Hydroxybenzoicacid | Drug Info | [25] | |||
| 20 | 4-Methoxybenzaldehyde | Drug Info | [25] | |||
| 21 | Coumaricacid | Drug Info | [25] | |||
| 22 | Coumarin/resveratrol hybrid derivative 1 | Drug Info | [26] | |||
| 23 | Cyclic peptide derivative 1 | Drug Info | [49] | |||
| 24 | Ethylvanillin | Drug Info | [25] | |||
| 25 | EUGENOL | Drug Info | [25] | |||
| 26 | FERULIC ACID | Drug Info | [25] | |||
| 27 | Heteroaryl-cyclopropylamine derivative 1 | Drug Info | [49] | |||
| 28 | Heteroaryl-cyclopropylamine derivative 3 | Drug Info | [49] | |||
| 29 | Lazabemide | Drug Info | [50], [51] | |||
| 30 | Lazabemide analog 1 | Drug Info | [26] | |||
| 31 | N-(2-phenylcyclopropyl) amino acid derivative 3 | Drug Info | [49] | |||
| 32 | Piperonal | Drug Info | [25] | |||
| 33 | PMID25399762-Compound-Table 6-10 | Drug Info | [25] | |||
| 34 | PMID25399762-Compound-Table 6-11 | Drug Info | [25] | |||
| 35 | PMID25399762-Compound-Table 6-12 | Drug Info | [25] | |||
| 36 | PMID25399762-Compound-Table 6-13 | Drug Info | [25] | |||
| 37 | PMID25399762-Compound-Table 6-14 | Drug Info | [25] | |||
| 38 | PMID25399762-Compound-Table 6-15 | Drug Info | [25] | |||
| 39 | PMID25399762-Compound-Table 6-9 | Drug Info | [25] | |||
| 40 | PMID25399762-Compound-Table 7-Vanillyl alcohol | Drug Info | [25] | |||
| 41 | PMID25399762-Compound-Table 7-Veratraldehyde | Drug Info | [25] | |||
| 42 | PMID25399762-Compound-Table1-C10 | Drug Info | [25] | |||
| 43 | PMID25399762-Compound-Table1-C11 | Drug Info | [25] | |||
| 44 | PMID25399762-Compound-Table1-C12 | Drug Info | [25] | |||
| 45 | PMID25399762-Compound-Table1-C13 | Drug Info | [25] | |||
| 46 | PMID25399762-Compound-Table1-C15 | Drug Info | [25] | |||
| 47 | PMID25399762-Compound-Table1-C16 | Drug Info | [25] | |||
| 48 | PMID25399762-Compound-Table1-C17 | Drug Info | [25] | |||
| 49 | PMID25399762-Compound-Table1-C18 | Drug Info | [25] | |||
| 50 | PMID25399762-Compound-Table1-C19 | Drug Info | [25] | |||
| 51 | PMID25399762-Compound-Table1-C2 | Drug Info | [25] | |||
| 52 | PMID25399762-Compound-Table1-C21 | Drug Info | [25] | |||
| 53 | PMID25399762-Compound-Table1-C22 | Drug Info | [25] | |||
| 54 | PMID25399762-Compound-Table1-C23 | Drug Info | [25] | |||
| 55 | PMID25399762-Compound-Table1-C24 | Drug Info | [25] | |||
| 56 | PMID25399762-Compound-Table1-C25 | Drug Info | [25] | |||
| 57 | PMID25399762-Compound-Table1-C3 | Drug Info | [25] | |||
| 58 | PMID25399762-Compound-Table1-C4 | Drug Info | [25] | |||
| 59 | PMID25399762-Compound-Table1-C5 | Drug Info | [25] | |||
| 60 | PMID25399762-Compound-Table1-C6 | Drug Info | [25] | |||
| 61 | PMID25399762-Compound-Table1-C7 | Drug Info | [25] | |||
| 62 | PMID25399762-Compound-Table1-C8 | Drug Info | [25] | |||
| 63 | PMID25399762-Compound-Table1-C9 | Drug Info | [25] | |||
| 64 | PMID29324067-Compound-38 | Drug Info | [26] | |||
| 65 | PMID29324067-Compound-40 | Drug Info | [26] | |||
| 66 | PMID29757691-Compound-4 | Drug Info | [52] | |||
| 67 | Secondary and tertiary (hetero)arylamide derivative 1 | Drug Info | [26] | |||
| 68 | T83193 | Drug Info | [25] | |||
| 69 | Tarnylcypromine derivative 2 | Drug Info | [49] | |||
| 70 | Tarnylcypromine derivative 3 | Drug Info | [49] | |||
| 71 | Tetra-hydro-isoquinoline derivative 1 | Drug Info | [52] | |||
| 72 | Tetra-hydro-isoquinoline derivative 2 | Drug Info | [52] | |||
| 73 | Tetra-hydro-isoquinoline derivative 3 | Drug Info | [52] | |||
| 74 | Tetra-hydro-isoquinoline derivative 4 | Drug Info | [52] | |||
| 75 | AS602868 | Drug Info | [44] | |||
| 76 | EVT-301 | Drug Info | [56] | |||
| 77 | HT-1067 | Drug Info | [57] | |||
| 78 | SL-25.1188 | Drug Info | [58] | |||
| 79 | RWJ-416457 | Drug Info | [39] | |||
| 80 | (+/-)-2-(4'-Benzyloxyphenyl)thiomorpholin-5-one | Drug Info | [59] | |||
| 81 | (+/-)-2-(4'-Benzyloxyphenyl)thiomorpholine | Drug Info | [59] | |||
| 82 | (+/-)-2-(4'-Butoxyphenyl)thiomorpholin-5-one | Drug Info | [59] | |||
| 83 | (+/-)-2-(4'-Butoxyphenyl)thiomorpholine | Drug Info | [59] | |||
| 84 | (+/-)-2-(4'-Ethoxyphenyl)thiomorpholin-5-one | Drug Info | [59] | |||
| 85 | (+/-)-2-(4'-Ethoxyphenyl)thiomorpholine | Drug Info | [59] | |||
| 86 | (+/-)-2-(4'-Methoxyphenyl)thiomorpholin-5-one | Drug Info | [59] | |||
| 87 | (+/-)-2-(4'-Methoxyphenyl)thiomorpholine | Drug Info | [59] | |||
| 88 | (+/-)-2-(4'-Propoxyphenyl)thiomorpholine | Drug Info | [59] | |||
| 89 | (+/-)-2-(4-fluorophenyl)-7-methoxychroman-4-one | Drug Info | [60] | |||
| 90 | (+/-)-2-(4-fluorophenyl)-7-methylchroman-4-one | Drug Info | [60] | |||
| 91 | (+/-)-2-(4-methoxyphenyl)-7-methylchroman-4-one | Drug Info | [60] | |||
| 92 | (+/-)-2-p-tolylchroman-4-one | Drug Info | [60] | |||
| 93 | (+/-)-2-Phenylthiomorpholin-5-one | Drug Info | [59] | |||
| 94 | (+/-)-2-Phenylthiomorpholine | Drug Info | [59] | |||
| 95 | (+/-)-7-fluoro-2-(4-fluorophenyl)chroman-4-one | Drug Info | [60] | |||
| 96 | (+/-)-7-fluoro-2-(4-methoxyphenyl)chroman-4-one | Drug Info | [60] | |||
| 97 | (+/-)-7-fluoro-2-phenylchroman-4-one | Drug Info | [60] | |||
| 98 | (+/-)-7-methoxy-2-(4-methoxyphenyl)chroman-4-one | Drug Info | [60] | |||
| 99 | (+/-)-7-methoxy-2-p-tolylchroman-4-one | Drug Info | [60] | |||
| 100 | (+/-)-7-methoxy-2-phenylchroman-4-one | Drug Info | [60] | |||
| 101 | (+/-)-7-methyl-2-phenylchroman-4-one | Drug Info | [60] | |||
| 102 | (6-Benzyloxy-2-naphthyl)-2-aminopropane | Drug Info | [61] | |||
| 103 | (6-Ethoxy-2-naphthyl)-2-aminopropane | Drug Info | [61] | |||
| 104 | (6-Methoxy-2-naphthyl)-2-aminopropane | Drug Info | [61] | |||
| 105 | (6-Propoxy-2-naphthyl)-2-aminopropane | Drug Info | [61] | |||
| 106 | (7-Benzyloxy-2-oxo-2H-chromen-4-yl)acetonitrile | Drug Info | [62] | |||
| 107 | (E)-5-(3-Chlorostyryl)isatin | Drug Info | [63] | |||
| 108 | (E)-5-Styrylisatin | Drug Info | [63] | |||
| 109 | (E)-6-Styrylisatin | Drug Info | [63] | |||
| 110 | (E)-8-(3-chlorostyryl)-caffeine | Drug Info | [64] | |||
| 111 | (R)(+)-2-(4-fluorophenyl)-7-methoxychroman-4-one | Drug Info | [60] | |||
| 112 | (R)(+)-7-fluoro-2-(4-fluorophenyl)chroman-4-one | Drug Info | [60] | |||
| 113 | (R)(+)-7-fluoro-2-p-tolylchroman-4-one | Drug Info | [60] | |||
| 114 | (R)(+)-7-fluoro-2-phenylchroman-4-one | Drug Info | [60] | |||
| 115 | (R)(+)-7-methyl-2-p-tolylchroman-4-one | Drug Info | [60] | |||
| 116 | (R)(+)-7-methyl-2-phenylchroman-4-one | Drug Info | [60] | |||
| 117 | (R)-3-Prop-2-ynylamino-indan-5-ol | Drug Info | [51], [65] | |||
| 118 | (R)-Indan-1-yl-methyl-prop-2-ynyl-amine | Drug Info | [51] | |||
| 119 | (R)-N2-{4-[(3-chlorobenzyl)oxy]benzyl}alaninamide | Drug Info | [66] | |||
| 120 | (R)-N2-{4-[(3-chlorobenzyl)oxy]benzyl}serinamide | Drug Info | [66] | |||
| 121 | (R)-N2-{4-[(3-fluorobenzyl)oxy]benzyl}alaninamide | Drug Info | [66] | |||
| 122 | (R/R)BEFLOXATONE | Drug Info | [67] | |||
| 123 | (S)(+)-2-(4-fluorophenyl)-7-methoxychroman-4-one | Drug Info | [60] | |||
| 124 | (S)(+)-7-fluoro-2-(4-fluorophenyl)chroman-4-one | Drug Info | [60] | |||
| 125 | (S)(+)-7-fluoro-2-p-tolylchroman-4-one | Drug Info | [60] | |||
| 126 | (S)(+)-7-fluoro-2-phenylchroman-4-one | Drug Info | [60] | |||
| 127 | (S)(+)-7-methyl-2-p-tolylchroman-4-one | Drug Info | [60] | |||
| 128 | (S)(+)-7-methyl-2-phenylchroman-4-one | Drug Info | [60] | |||
| 129 | (S)-2-amino-1-(4-propylthiophenyl)-propane | Drug Info | [68] | |||
| 130 | (S)-N2-[4-(benzyloxy)benzyl]alaninamide | Drug Info | [66] | |||
| 131 | (S)-N2-{4-[(3-chlorobenzyl)oxy]benzyl}alaninamide | Drug Info | [66] | |||
| 132 | (S)-N2-{4-[(3-chlorobenzyl)oxy]benzyl}serinamide | Drug Info | [66] | |||
| 133 | (S)-N2-{4-[(3-fluorobenzyl)oxy]benzyl}serinamide | Drug Info | [66] | |||
| 134 | (S)-N2-{4-[(4-chlorobenzyl)oxy]benzyl}alaninamide | Drug Info | [66] | |||
| 135 | (S)-N2-{4-[(4-chlorobenzyl)oxy]benzyl}serinamide | Drug Info | [66] | |||
| 136 | (S)-N2-{4-[(4-nitrobenzyl)oxy]benzyl}serinamide | Drug Info | [66] | |||
| 137 | 1,2,3,4-Tetrahydro-pyrazino[1,2-a]indole | Drug Info | [69] | |||
| 138 | 1,4-diphenyl-(1E,3E)-1,3-butadiene | Drug Info | [51] | |||
| 139 | 1-(4-(benzyloxy)phenyl)propan-2-amine | Drug Info | [61] | |||
| 140 | 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine | Drug Info | [70] | |||
| 141 | 1H-Indole-2,3-dione | Drug Info | [51], [71] | |||
| 142 | 2,3,4,5-Tetrahydro-1H-pyrido[4,3-b]indole | Drug Info | [45] | |||
| 143 | 2-(2,4-dichlorophenyl)-4,5-dihydro-1H-imidazole | Drug Info | [72] | |||
| 144 | 2-(2-cycloheptylidenehydrazinyl)-4-phenylthiazole | Drug Info | [73] | |||
| 145 | 2-(2-cyclohexylidenehydrazinyl)-4-p-tolylthiazole | Drug Info | [73] | |||
| 146 | 2-(2-cyclohexylidenehydrazinyl)-4-phenylthiazole | Drug Info | [73] | |||
| 147 | 2-(2-cyclopentylidenehydrazinyl)-4-phenylthiazole | Drug Info | [73] | |||
| 148 | 2-(3-nitrophenyl)-4,5-dihydro-1H-imidazole | Drug Info | [72] | |||
| 149 | 2-(4,5-dihydro-1H-imidazol-2-yl)quinoline | Drug Info | [72] | |||
| 150 | 2-(4-chlorophenyl)-4,5-dihydro-1H-imidazole | Drug Info | [72] | |||
| 151 | 2-(4-fluorophenyl)-7-methoxy-4H-chromen-4-one | Drug Info | [60] | |||
| 152 | 2-(4-methoxyphenyl)-4H-chromene-4-thione | Drug Info | [60] | |||
| 153 | 2-(5-phenyl-furan-2-yl)-4,5-dihydro-1H-imidazole | Drug Info | [74] | |||
| 154 | 2-(naphthalen-2-yl)-4,5-dihydro-1H-imidazole | Drug Info | [72] | |||
| 155 | 2-BFi | Drug Info | [72] | |||
| 156 | 2-Bromo-N-(2-morpholinoethyl)nicotinamide | Drug Info | [75] | |||
| 157 | 2-Bromo-N-(3-morpholinopropyl)nicotinamide | Drug Info | [75] | |||
| 158 | 2-Chloro-N-(2-morpholinoethyl)nicotinamide | Drug Info | [75] | |||
| 159 | 2-Chloro-N-(3-morpholinopropyl)nicotinamide | Drug Info | [75] | |||
| 160 | 2-Furan-2-yl-4,5-dihydro-1H-imidazole | Drug Info | [76] | |||
| 161 | 2-Hydrazino-3-methyl-4(3H)-quinazolinone | Drug Info | [77] | |||
| 162 | 2-methyl-9H-indeno[2,1-d]pyrimidin-9-one | Drug Info | [78] | |||
| 163 | 2-oxo-N-m-tolyl-2H-chromene-3-carboxamide | Drug Info | [79] | |||
| 164 | 2-oxo-N-p-tolyl-2H-chromene-3-carboxamide | Drug Info | [79] | |||
| 165 | 2-oxo-N-phenyl-2H-chromene-3-carboxamide | Drug Info | [79] | |||
| 166 | 2-p-tolyl-4,5-dihydro-1H-imidazole | Drug Info | [72] | |||
| 167 | 2-p-tolyl-4H-chromen-4-one | Drug Info | [60] | |||
| 168 | 2-p-tolyl-4H-chromene-4-thione | Drug Info | [60] | |||
| 169 | 2-Phenoxymethyl-4,5-dihydro-1H-imidazole | Drug Info | [76] | |||
| 170 | 2-phenyl-9H-indeno[2,1-d]pyrimidine | Drug Info | [78] | |||
| 171 | 2-Phenyl-cyclopropylamine hydrochloride | Drug Info | [80] | |||
| 172 | 2-[7-(Benzyloxy)-2-oxo-2H-chromen-4-yl]acetamide | Drug Info | [62] | |||
| 173 | 3,4-Benzo-7-(beta-bromoallyloxy)-8-methylcoumarin | Drug Info | [81] | |||
| 174 | 3,4-Benzo-7-acetonyloxy-8-methoxycoumarin | Drug Info | [81] | |||
| 175 | 3,4-Dichloro-N-(2-methyl-1H-indol-5-yl)benzamide | Drug Info | [82] | |||
| 176 | 3-(3-methoxyphenyl)-6-methyl-2H-chromen-2-one | Drug Info | [83] | |||
| 177 | 3-(4-hydroxyphenyl)-6-methyl-2H-chromen-2-one | Drug Info | [83] | |||
| 178 | 3-(4-methoxyphenyl)-6-methyl-2H-chromen-2-one | Drug Info | [83] | |||
| 179 | 3-(phenoxymethyl)-5H-indeno[1,2-c]pyridazin-5-one | Drug Info | [78] | |||
| 180 | 3-Chloro-N-(2-methyl-1H-indol-5-yl)benzamide | Drug Info | [82] | |||
| 181 | 3-phenyl-9H-indeno[1,2-e][1,2,4]triazin-9-one | Drug Info | [78] | |||
| 182 | 4,8-Dimethyl-7-(2'-oxocyclohexyloxy)coumarin | Drug Info | [81] | |||
| 183 | 4,9-Dihydro-3H-beta-carboline | Drug Info | [69] | |||
| 184 | 4-(2-oxo-2H-chromene-3-carboxamido)benzoic acid | Drug Info | [79] | |||
| 185 | 4-(Aminomethyl)-7-(benzyloxy)-2H-chromen-2-one | Drug Info | [62] | |||
| 186 | 4-HYDROXY-N-PROPARGYL-1(R)-AMINOINDAN | Drug Info | [65] | |||
| 187 | 4-methyl-7-(2-oxocyclopentyloxy)-2H-chromen-2-one | Drug Info | [81] | |||
| 188 | 4-oxo-4H-chromene-3-carboxylic acid | Drug Info | [85] | |||
| 189 | 4-phenyl-1,2,3,6-tetrahydropyridine | Drug Info | [70] | |||
| 190 | 5-Aminomethyl-3-pyrrol-1-yl-oxazolidin-2-one | Drug Info | [67] | |||
| 191 | 5-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [45] | |||
| 192 | 5-Bromo-4,9-dihydro-3H-beta-carboline | Drug Info | [45] | |||
| 193 | 5-Hydroxymethyl-3-pyrrol-1-yl-oxazolidin-2-one | Drug Info | [67] | |||
| 194 | 5-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [45] | |||
| 195 | 5-QUINOXALIN-6-YLMETHYLENE-THIAZOLIDINE-2,4-DIONE | Drug Info | [86] | |||
| 196 | 6-amino-9-methoxy-7H-furo[3,2-g]chromen-7-one | Drug Info | [81] | |||
| 197 | 6-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [45] | |||
| 198 | 6-Bromo-4,9-dihydro-3H-beta-carboline | Drug Info | [45] | |||
| 199 | 6-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [69] | |||
| 200 | 6-Methoxy-4,9-dihydro-3H-beta-carboline | Drug Info | [69] | |||
| 201 | 7-(3-chlorobenzyloxy)-4-carboxaldehyde-coumarin | Drug Info | [87] | |||
| 202 | 7-Acetonyloxy-3,4-cyclohexene-8-methylcoumarin | Drug Info | [81] | |||
| 203 | 7-Acetonyloxy-3,4-cyclopentene-8-methylcoumarin | Drug Info | [81] | |||
| 204 | 7-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [45] | |||
| 205 | 7-fluoro-2-p-tolyl-4H-chromen-4-one | Drug Info | [60] | |||
| 206 | 7-fluoro-2-p-tolyl-4H-chromene-4-thione | Drug Info | [60] | |||
| 207 | 7-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [76] | |||
| 208 | 7-methoxy-2-p-tolyl-4H-chromene-4-thione | Drug Info | [60] | |||
| 209 | 7-Methoxy-9H-beta-carboline | Drug Info | [45] | |||
| 210 | 7-methyl-2-p-tolyl-4H-chromene-4-thione | Drug Info | [60] | |||
| 211 | 8-(3-Bromobenzyloxy)caffeine | Drug Info | [88] | |||
| 212 | 8-(3-Chlorobenzyloxy)caffeine | Drug Info | [88] | |||
| 213 | 8-(3-Fluorobenzyloxy)caffeine | Drug Info | [88] | |||
| 214 | 8-(3-Methoxybenzyloxy)caffeine | Drug Info | [88] | |||
| 215 | 8-(3-Methylbenzyloxy)caffeine | Drug Info | [88] | |||
| 216 | 8-Benzyloxycaffeine | Drug Info | [88] | |||
| 217 | 8-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [45] | |||
| 218 | 8-Bromo-4,9-dihydro-3H-beta-carboline | Drug Info | [45] | |||
| 219 | 8-Bromo-6-methyl-3-(4'-methoxyphenyl)coumarin | Drug Info | [89] | |||
| 220 | 8-Bromo-6-methyl-3-phenylcoumarin | Drug Info | [89] | |||
| 221 | 8-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [45] | |||
| 222 | 8-[(3-Trifluoromethyl)benzyloxy]caffeine | Drug Info | [88] | |||
| 223 | 9-Methyl-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [45] | |||
| 224 | Butyl-methyl-prop-2-ynyl-amine hydrochloride | Drug Info | [91] | |||
| 225 | C-(1H-Indol-3-yl)-methylamine | Drug Info | [45] | |||
| 226 | CGS-19281A | Drug Info | [69] | |||
| 227 | CHALCONE | Drug Info | [92] | |||
| 228 | Cis-2-(4-chlorophenyl)-2-fluorocyclopropanamine | Drug Info | [93] | |||
| 229 | Cis-2-Fluoro-2-(4-methoxyphenyl)cyclopropylamine | Drug Info | [93] | |||
| 230 | Cis-2-fluoro-2-phenylcyclopropanamine | Drug Info | [93] | |||
| 231 | Farnesol | Drug Info | [65] | |||
| 232 | Flavanone | Drug Info | [60] | |||
| 233 | Flavin-Adenine Dinucleotide | Drug Info | [94] | |||
| 234 | HYDRAZINECARBOXAMIDE | Drug Info | [80] | |||
| 235 | IPRONIAZIDE | Drug Info | [75] | |||
| 236 | JD-0100 | Drug Info | [39] | |||
| 237 | L-136662 | Drug Info | [86] | |||
| 238 | Lauryl Dimethylamine-N-Oxide | Drug Info | [94] | |||
| 239 | Methyl piperate | Drug Info | [48] | |||
| 240 | Methyl-(1,2,3,4-tetrahydro-naphthalen-1-yl)-amine | Drug Info | [96] | |||
| 241 | Methyl-pentyl-prop-2-ynyl-amine oxalic acid | Drug Info | [91] | |||
| 242 | N-(1H-Indol-2-ylmethyl)-N-methyl-N-phenylamine | Drug Info | [97] | |||
| 243 | N-(1H-Indol-2-ylmethyl)-N-phenylamine | Drug Info | [97] | |||
| 244 | N-(2-aminoethyl)-2-oxo-2H-chromene-3-carboxamide | Drug Info | [79] | |||
| 245 | N-(2-aminoethyl)-p-chlorobenzamide | Drug Info | [65] | |||
| 246 | N-(2-Methyl-1H-indol-5-yl)benzamide | Drug Info | [82] | |||
| 247 | N-(2-Methyl-1H-indol-5-yl)cyclohexanecarboxamide | Drug Info | [82] | |||
| 248 | N-(2-phenylethyl),N-(pyrrol-2-ylmethyl)amine | Drug Info | [98] | |||
| 249 | N-(3-Phenylpropyl)-1H-indole-2-carboxamide | Drug Info | [97] | |||
| 250 | N-(4-Ethylphenyl)-2-oxo-2H-chromene-3-carboxamide | Drug Info | [79] | |||
| 251 | N-(4-Phenylbutyl)-1H-indole-2-carboxamide | Drug Info | [97] | |||
| 252 | N-(benzyl),N-(pyrrol-2-ylmethyl)amine | Drug Info | [98] | |||
| 253 | N-(propargyl),N-(pyrrol-2-ylmethyl)amine | Drug Info | [98] | |||
| 254 | N-benzyl-2-oxo-2H-chromene-3-carboxamide | Drug Info | [79] | |||
| 255 | N-Benzyl-N-(1H-indol-2-ylmethyl)-N-methylamine | Drug Info | [97] | |||
| 256 | N-cyclohexyl-2-oxo-2H-chromene-3-carboxamide | Drug Info | [79] | |||
| 257 | N-isobutyl-2-oxo-2H-chromene-3-carboxamide | Drug Info | [79] | |||
| 258 | N-methyl,N-(benzyl),N-(pyrrol-2-ylmethyl)amine | Drug Info | [98] | |||
| 259 | N-methyl,N-(propargyl),N-(pyrrol-2-ylmethyl)amine | Drug Info | [98] | |||
| 260 | N-Methyl,N-phenyl-1H-indole-2-carboxamide | Drug Info | [97] | |||
| 261 | N-Methyl-N-Propargyl-1(R)-Aminoindan | Drug Info | [65] | |||
| 262 | N-Phenyl-1H-indole-2-carboxamide | Drug Info | [97] | |||
| 263 | N-Propargyl-1(S)-Aminoindan | Drug Info | [65] | |||
| 264 | N2-[4-(benzyloxy)benzyl]glycinamide | Drug Info | [66] | |||
| 265 | N2-{4-[(3-chlorobenzyl)oxy]benzyl}glycinamide | Drug Info | [66] | |||
| 266 | N2-{4-[(3-fluorobenzyl)oxy]benzyl}glycinamide | Drug Info | [66] | |||
| 267 | N2-{4-[(4-chlorobenzyl)oxy]benzyl}glycinamide | Drug Info | [66] | |||
| 268 | N2-{4-[(4-nitrobenzyl)oxy]benzyl}glycinamide | Drug Info | [66] | |||
| 269 | NSC-50187 | Drug Info | [60] | |||
| 270 | NSC-93405 | Drug Info | [60] | |||
| 271 | NW-1772 | Drug Info | [39] | |||
| 272 | Phenyl 4-(4,5-dihydro-1H-imidazol-2-yl)benzoate | Drug Info | [72] | |||
| 273 | PNU-22394 | Drug Info | [45] | |||
| 274 | RS-1636 | Drug Info | [41] | |||
| 275 | SKL-PD | Drug Info | [39] | |||
| 276 | TRACIZOLINE | Drug Info | [76] | |||
| 277 | Trans-2-(4-chlorophenyl)-2-fluorocyclopropanamine | Drug Info | [93] | |||
| 278 | Trans-2-fluoro-2-(4-fluorophenyl)cyclopropanamine | Drug Info | [93] | |||
| 279 | Trans-2-fluoro-2-p-tolylcyclopropanamine | Drug Info | [93] | |||
| 280 | Trans-2-fluoro-2-phenylcyclopropylamin | Drug Info | [93] | |||
| 281 | TRYPTOLINE | Drug Info | [76] | |||
| 282 | VAR-10300 | Drug Info | [39] | |||
| 283 | [(1e)-4-Phenylbut-1-Enyl]Benzene | Drug Info | [65] | |||
| Antagonist | [+] 2 Antagonist drugs | + | ||||
| 1 | Beta-methoxyamphetamine | Drug Info | [90] | |||
| 2 | MMDA | Drug Info | [94] | |||
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Drug Binding Sites of Target | Top | |||||
|---|---|---|---|---|---|---|
| Ligand Name: Zonisamide | Ligand Info | |||||
| Structure Description | Human monoamine oxidase B in complex with zonisamide | PDB:3PO7 | ||||
| Method | X-ray diffraction | Resolution | 1.80 Å | Mutation | No | [99] |
| PDB Sequence |
NKCDVVVVGG
12 GISGMAAAKL22 LHDSGLNVVV32 LEARDRVGGR42 TYTLRNQKVK52 YVDLGGSYVG 62 PTQNRILRLA72 KELGLETYKV82 NEVERLIHHV92 KGKSYPFRGP102 FPPVWNPITY 112 LDHNNFWRTM122 DDMGREIPSD132 APWKAPLAEE142 WDNMTMKELL152 DKLCWTESAK 162 QLATLFVNLC172 VTAETHEVSA182 LWFLWYVKQC192 GGTTRIISTT202 NGGQERKFVG 212 GSGQVSERIM222 DLLGDRVKLE232 RPVIYIDQTR242 ENVLVETLNH252 EMYEAKYVIS 262 AIPPTLGMKI272 HFNPPLPMMR282 NQMITRVPLG292 SVIKCIVYYK302 EPFWRKKDYC 312 GTMIIDGEEA322 PVAYTLDDTK332 PEGNYAAIMG342 FILAHKARKL352 ARLTKEERLK 362 KLCELYAKVL372 GSLEALEPVH382 YEEKNWCEEQ392 YSGGCYTTYF402 PPGILTQYGR 412 VLRQPVDRIY422 FAGTETATHW432 SGYMEGAVEA442 GERAAREILH452 AMGKIPEDEI 462 WQSEPESVDV472 PAQPITTTFL482 ERHLPSVPGL492 LRLIGLTTI
|
|||||
|
|
||||||
| Ligand Name: (R)-3-Prop-2-ynylamino-indan-5-ol | Ligand Info | |||||
| Structure Description | Crystal structure of MAOB in complex with 6-hydroxy-N-propargyl-1(R)-aminoindan | PDB:1S3E | ||||
| Method | X-ray diffraction | Resolution | 1.60 Å | Mutation | No | [100] |
| PDB Sequence |
NKCDVVVVGG
12 GISGMAAAKL22 LHDSGLNVVV32 LEARDRVGGR42 TYTLRNQKVK52 YVDLGGSYVG 62 PTQNRILRLA72 KELGLETYKV82 NEVERLIHHV92 KGKSYPFRGP102 FPPVWNPITY 112 LDHNNFWRTM122 DDMGREIPSD132 APWKAPLAEE142 WDNMTMKELL152 DKLCWTESAK 162 QLATLFVNLC172 VTAETHEVSA182 LWFLWYVKQC192 GGTTRIISTT202 NGGQERKFVG 212 GSGQVSERIM222 DLLGDRVKLE232 RPVIYIDQTR242 ENVLVETLNH252 EMYEAKYVIS 262 AIPPTLGMKI272 HFNPPLPMMR282 NQMITRVPLG292 SVIKCIVYYK302 EPFWRKKDYC 312 GTMIIDGEEA322 PVAYTLDDTK332 PEGNYAAIMG342 FILAHKARKL352 ARLTKEERLK 362 KLCELYAKVL372 GSLEALEPVH382 YEEKNWCEEQ392 YSGGCYTTYF402 PPGILTQYGR 412 VLRQPVDRIY422 FAGTETATHW432 SGYMEGAVEA442 GERAAREILH452 AMGKIPEDEI 462 WQSEPESVDV472 PAQPITTTFL482 ERHLPSVPGL492 LRLIGLTTI
|
|||||
|
|
||||||
| Click to View More Binding Site Information of This Target with Different Ligands | ||||||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Tissue Distribution
of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues.
The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects
(Nat Rev Drug Discov, 20: 64-81, 2021).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Biological Network Descriptors
of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.
The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information
(Front Pharmacol, 9, 1245, 2018;
Curr Opin Struct Biol. 44:134-142, 2017).
Human Similarity Proteins
Human Tissue Distribution
Human Pathway Affiliation
Biological Network Descriptors
|
|
|
There is no similarity protein (E value < 0.005) for this target
|
|
Note:
If a protein has TS (tissue specficity) scores at least in one tissue >= 2.5, this protein is called tissue-enriched (including tissue-enriched-but-not-specific and tissue-specific). In the plots, the vertical lines are at thresholds 2.5 and 4.
|
| KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
|---|---|---|---|
| Glycine, serine and threonine metabolism | hsa00260 | Affiliated Target |
|
| Class: Metabolism => Amino acid metabolism | Pathway Hierarchy | ||
| Arginine and proline metabolism | hsa00330 | Affiliated Target |
|
| Class: Metabolism => Amino acid metabolism | Pathway Hierarchy | ||
| Histidine metabolism | hsa00340 | Affiliated Target |
|
| Class: Metabolism => Amino acid metabolism | Pathway Hierarchy | ||
| Tyrosine metabolism | hsa00350 | Affiliated Target |
|
| Class: Metabolism => Amino acid metabolism | Pathway Hierarchy | ||
| Phenylalanine metabolism | hsa00360 | Affiliated Target |
|
| Class: Metabolism => Amino acid metabolism | Pathway Hierarchy | ||
| Tryptophan metabolism | hsa00380 | Affiliated Target |
|
| Class: Metabolism => Amino acid metabolism | Pathway Hierarchy | ||
| Drug metabolism - cytochrome P450 | hsa00982 | Affiliated Target |
|
| Class: Metabolism => Xenobiotics biodegradation and metabolism | Pathway Hierarchy | ||
| Serotonergic synapse | hsa04726 | Affiliated Target |
|
| Class: Organismal Systems => Nervous system | Pathway Hierarchy | ||
| Dopaminergic synapse | hsa04728 | Affiliated Target |
|
| Class: Organismal Systems => Nervous system | Pathway Hierarchy | ||
| Click to Show/Hide the Information of Affiliated Human Pathways | |||
| Degree | 2 | Degree centrality | 2.15E-04 | Betweenness centrality | 0.00E+00 |
|---|---|---|---|---|---|
| Closeness centrality | 1.54E-01 | Radiality | 1.22E+01 | Clustering coefficient | 1.00E+00 |
| Neighborhood connectivity | 9.00E+00 | Topological coefficient | 6.43E-01 | Eccentricity | 12 |
| Download | Click to Download the Full PPI Network of This Target | ||||
| Chemical Structure based Activity Landscape of Target | Top |
|---|---|
| Drug Property Profile of Target | Top | |
|---|---|---|
| (1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
|
||
| (3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
|
||
| (5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
|
||
| "RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five | ||
| Co-Targets | Top | |||||
|---|---|---|---|---|---|---|
| Co-Targets | ||||||
| Target Poor or Non Binders | Top | |||||
|---|---|---|---|---|---|---|
| Target Poor or Non Binders | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| BioCyc | [+] 5 BioCyc Pathways | + | ||||
| 1 | Superpathway of tryptophan utilization | |||||
| 2 | Tryptophan degradation via tryptamine | |||||
| 3 | Dopamine degradation | |||||
| 4 | Putrescine degradation III | |||||
| 5 | Noradrenaline and adrenaline degradation | |||||
| KEGG Pathway | [+] 13 KEGG Pathways | + | ||||
| 1 | Glycine, serine and threonine metabolism | |||||
| 2 | Arginine and proline metabolism | |||||
| 3 | Histidine metabolism | |||||
| 4 | Tyrosine metabolism | |||||
| 5 | Phenylalanine metabolism | |||||
| 6 | Tryptophan metabolism | |||||
| 7 | Drug metabolism - cytochrome P450 | |||||
| 8 | Metabolic pathways | |||||
| 9 | Serotonergic synapse | |||||
| 10 | Dopaminergic synapse | |||||
| 11 | Cocaine addiction | |||||
| 12 | Amphetamine addiction | |||||
| 13 | Alcoholism | |||||
| Panther Pathway | [+] 3 Panther Pathways | + | ||||
| 1 | Adrenaline and noradrenaline biosynthesis | |||||
| 2 | 5-Hydroxytryptamine degredation | |||||
| 3 | Dopamine receptor mediated signaling pathway | |||||
| PID Pathway | [+] 1 PID Pathways | + | ||||
| 1 | Alpha-synuclein signaling | |||||
| WikiPathways | [+] 3 WikiPathways | + | ||||
| 1 | Tryptophan metabolism | |||||
| 2 | Dopamine metabolism | |||||
| 3 | Phase 1 - Functionalization of compounds | |||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Tranylcypromine: new perspectives on an "old" drug. Eur Arch Psychiatry Clin Neurosci. 2006 Aug;256(5):268-73. | |||||
| REF 2 | 2017 FDA drug approvals.Nat Rev Drug Discov. 2018 Feb;17(2):81-85. | |||||
| REF 3 | Multiple mechanisms of action: the pharmacological profile of budipine. J Neural Transm Suppl. 1999;56:83-105. | |||||
| REF 4 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
| REF 5 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7266). | |||||
| REF 6 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 011909. | |||||
| REF 7 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6641). | |||||
| REF 8 | Novel pharmacological targets for the treatment of Parkinson's disease. Nat Rev Drug Discov. 2006 Oct;5(10):845-54. | |||||
| REF 9 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2018 | |||||
| REF 10 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6639). | |||||
| REF 11 | ClinicalTrials.gov (NCT00640159) Tolerability and Efficacy of Switch From Oral Selegiline to Orally Disintegrating Selegiline (Zelapar) in Patients With Parkinson's Disease. U.S. National Institutes of Health. | |||||
| REF 12 | The fight against drug-resistant malaria: novel plasmodial targets and antimalarial drugs. Curr Med Chem. 2008;15(2):161-71. | |||||
| REF 13 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 018557. | |||||
| REF 14 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 15 | ClinicalTrials.gov (NCT03867253) A Multicentre,Randomised, Double-blind, Placebo-controlled, 3-arm, 24-week Parallel-group Study to Evaluate the Safety, Tolerability and Preliminary Efficacy of ORY-2001 in Patients With Mild-moderate Alzheimer's Disease. U.S.National Institutes of Health. | |||||
| REF 16 | Indantadol, a novel NMDA antagonist and nonselective MAO inhibitor for the potential treatment of neuropathic pain. IDrugs. 2007 Sep;10(9):636-44. | |||||
| REF 17 | Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26. | |||||
| REF 18 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 19 | Ladostigil: a novel multimodal neuroprotective drug with cholinesterase and brain-selective monoamine oxidase inhibitory activities for Alzheimer's disease treatment. Curr Drug Targets. 2012 Apr;13(4):483-94. | |||||
| REF 20 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026046) | |||||
| REF 21 | ClinicalTrials.gov (NCT00607451) Safety, Tolerability, PK and PD Study of Neu-120 in the Treatment of Levodopa-induced Dyskinesia. U.S. National Institutes of Health. | |||||
| REF 22 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2489). | |||||
| REF 23 | ClinicalTrials.gov (NCT01383694) Effect Of Piperine In Patients With Oropharyngeal Dysphagia. U.S. National Institutes of Health. | |||||
| REF 24 | CYP-dependent metabolism of PF9601N, a new monoamine oxidase-B inhibitor, by C57BL/6 mouse and human liver microsomes. J Pharm Pharm Sci. 2007;10(4):473-85. | |||||
| REF 25 | Novel monoamine oxidase inhibitors: a patent review (2012 - 2014).Expert Opin Ther Pat. 2015 Jan;25(1):91-110. | |||||
| REF 26 | MAO inhibitors and their wider applications: a patent review.Expert Opin Ther Pat. 2018 Mar;28(3):211-226. | |||||
| REF 27 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002656) | |||||
| REF 28 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009941) | |||||
| REF 29 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800024230) | |||||
| REF 30 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800034020) | |||||
| REF 31 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012921) | |||||
| REF 32 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016773) | |||||
| REF 33 | Milacemide, the selective substrate and enzyme-activated specific inhibitor of monoamine oxidase B, increases dopamine but not serotonin in caudate nucleus of rhesus monkey. Neurochem Int. 1990;17(2):325-9. | |||||
| REF 34 | Dose-dependent activation of distinct hypertrophic pathways by serotonin in cardiac cells. Am J Physiol Heart Circ Physiol. 2009 Aug;297(2):H821-8. | |||||
| REF 35 | Limitation of adipose tissue enlargement in rats chronically treated with semicarbazide-sensitive amine oxidase and monoamine oxidase inhibitors. Pharmacol Res. 2008 Jun;57(6):426-34. | |||||
| REF 36 | Glyceraldehyde-3-phosphate dehydrogenase-monoamine oxidase B-mediated cell death-induced by ethanol is prevented by rasagiline and 1-R-aminoindan. Neurotox Res. 2009 Aug;16(2):148-59. | |||||
| REF 37 | Emerging drugs for epilepsy. Expert Opin Emerg Drugs. 2007 Sep;12(3):407-22. | |||||
| REF 38 | Emerging drugs for Parkinson's disease. Expert Opin Emerg Drugs. 2006 Sep;11(3):403-17. | |||||
| REF 39 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2490). | |||||
| REF 40 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | |||||
| REF 41 | Novel monoamine oxidase inhibitors, 3-(2-aminoethoxy)-1,2-benzisoxazole derivatives, and their differential reversibility. Jpn J Pharmacol. 2002 Feb;88(2):174-82. | |||||
| REF 42 | Dopamine D2 receptors: a potential pharmacological target for nomifensine and tranylcypromine but not other antidepressant treatments. Pharmacol Biochem Behav. 1995 Aug;51(4):565-9. | |||||
| REF 43 | Rasagiline (TVP-1012): a new selective monoamine oxidase inhibitor for Parkinson's disease. Am J Geriatr Pharmacother. 2006 Dec;4(4):330-46. | |||||
| REF 44 | Inhibition of rat brain monoamine oxidase activities by psoralen and isopsoralen: implications for the treatment of affective disorders. Pharmacol Toxicol. 2001 Feb;88(2):75-80. | |||||
| REF 45 | Binding of beta-carbolines at imidazoline I2 receptors: a structure-affinity investigation. Bioorg Med Chem Lett. 2004 Feb 23;14(4):999-1002. | |||||
| REF 46 | Sembragiline Alzheimer's Disease (Phase 2). Evotech AG, Roche. | |||||
| REF 47 | Company report (Neurim Pharmaceuticals) | |||||
| REF 48 | Proposed structural basis of interaction of piperine and related compounds with monoamine oxidases. Bioorg Med Chem Lett. 2010 Jan 15;20(2):537-40. | |||||
| REF 49 | LSD1 inhibitors: a patent review (2010-2015).Expert Opin Ther Pat. 2016 May;26(5):565-80. | |||||
| REF 50 | The activity of MAO A and B in rat renal cells and tubules. Life Sci. 1998;62(8):727-37. | |||||
| REF 51 | Docking studies on monoamine oxidase-B inhibitors: estimation of inhibition constants (K(i)) of a series of experimentally tested compounds. Bioorg Med Chem Lett. 2005 Oct 15;15(20):4438-46. | |||||
| REF 52 | A patent review of butyrylcholinesterase inhibitors and reactivators 2010-2017.Expert Opin Ther Pat. 2018 Jun;28(6):455-465. | |||||
| REF 53 | mGlu5 negative allosteric modulators: a patent review (2013 - 2016).Expert Opin Ther Pat. 2017 Jun;27(6):691-706. | |||||
| REF 54 | Structural and mechanistic studies of mofegiline inhibition of recombinant human monoamine oxidase B. J Med Chem. 2008 Dec 25;51(24):8019-26. | |||||
| REF 55 | Pharmacokinetics and pharmacodynamics of the monoamine oxidase B inhibitor mofegiline assessed during a phase I dose tolerance trial. Clin Pharmacol Ther. 1995 Sep;58(3):342-53. | |||||
| REF 56 | Assessment of MAO-B occupancy in the brain with PET and [11C]-L-deprenyl-D2: a dose-finding study with a novel MAO-B inhibitor, EVT 301. Clin Pharmacol Ther. 2009 May;85(5):506-12. | |||||
| REF 57 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800034020) | |||||
| REF 58 | [(11)C]SL25.1188, a new reversible radioligand to study the monoamine oxidase type B with PET: preclinical characterisation in nonhuman primate. Synapse. 2010 Jan;64(1):61-9. | |||||
| REF 59 | 2-Arylthiomorpholine derivatives as potent and selective monoamine oxidase B inhibitors. Bioorg Med Chem. 2010 Feb 15;18(4):1388-95. | |||||
| REF 60 | A new series of flavones, thioflavones, and flavanones as selective monoamine oxidase-B inhibitors. Bioorg Med Chem. 2010 Feb;18(3):1273-9. | |||||
| REF 61 | Naphthylisopropylamine and N-benzylamphetamine derivatives as monoamine oxidase inhibitors. Bioorg Med Chem. 2009 Mar 15;17(6):2452-60. | |||||
| REF 62 | Discovery of a novel class of potent coumarin monoamine oxidase B inhibitors: development and biopharmacological profiling of 7-[(3-chlorobenzyl)ox... J Med Chem. 2009 Nov 12;52(21):6685-706. | |||||
| REF 63 | Inhibition of monoamine oxidase by (E)-styrylisatin analogues. Bioorg Med Chem Lett. 2009 May 1;19(9):2509-13. | |||||
| REF 64 | Synthesis and in vitro evaluation of pteridine analogues as monoamine oxidase B and nitric oxide synthase inhibitors. Bioorg Med Chem. 2009 Nov 1;17(21):7523-30. | |||||
| REF 65 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | |||||
| REF 66 | Solid-phase synthesis and insights into structure-activity relationships of safinamide analogues as potent and selective inhibitors of type B monoa... J Med Chem. 2007 Oct 4;50(20):4909-16. | |||||
| REF 67 | 3-(1H-Pyrrol-1-yl)-2-oxazolidinones as reversible, highly potent, and selective inhibitors of monoamine oxidase type A. J Med Chem. 2002 Mar 14;45(6):1180-3. | |||||
| REF 68 | Human and rat monoamine oxidase-A are differentially inhibited by (S)-4-alkylthioamphetamine derivatives: insights from molecular modeling studies. Bioorg Med Chem. 2007 Aug 1;15(15):5198-206. | |||||
| REF 69 | Pyrazino[1,2-a]indoles as novel high-affinity and selective imidazoline I(2) receptor ligands. Bioorg Med Chem Lett. 2004 Feb 23;14(4):1003-5. | |||||
| REF 70 | Further explorations of unnatural alkaloids. J Nat Prod. 1985 Nov-Dec;48(6):878-93. | |||||
| REF 71 | DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-41. | |||||
| REF 72 | Ultrasound promoted synthesis of 2-imidazolines in water: a greener approach toward monoamine oxidase inhibitors. Bioorg Med Chem Lett. 2009 Jan 15;19(2):546-9. | |||||
| REF 73 | Synthesis, semipreparative HPLC separation, biological evaluation, and 3D-QSAR of hydrazothiazole derivatives as human monoamine oxidase B inhibitors. Bioorg Med Chem. 2010 Jul 15;18(14):5063-70. | |||||
| REF 74 | 3-[5-(4,5-dihydro-1H-imidazol-2-yl)-furan-2-yl]phenylamine (Amifuraline), a promising reversible and selective peripheral MAO-A inhibitor. J Med Chem. 2006 Sep 7;49(18):5578-86. | |||||
| REF 75 | Design of novel nicotinamides as potent and selective monoamine oxidase a inhibitors. Bioorg Med Chem. 2010 Feb 15;18(4):1659-64. | |||||
| REF 76 | Binding of an imidazopyridoindole at imidazoline I2 receptors. Bioorg Med Chem Lett. 2004 Jan 19;14(2):527-9. | |||||
| REF 77 | New pyrazoline bearing 4(3H)-quinazolinone inhibitors of monoamine oxidase: synthesis, biological evaluation, and structural determinants of MAO-A ... Bioorg Med Chem. 2009 Jan 15;17(2):675-89. | |||||
| REF 78 | Synthesis and monoamine oxidase inhibitory activity of new pyridazine-, pyrimidine- and 1,2,4-triazine-containing tricyclic derivatives. J Med Chem. 2007 Nov 1;50(22):5364-71. | |||||
| REF 79 | Synthesis, molecular modeling, and selective inhibitory activity against human monoamine oxidases of 3-carboxamido-7-substituted coumarins. J Med Chem. 2009 Apr 9;52(7):1935-42. | |||||
| REF 80 | Fluorinated phenylcyclopropylamines. 2. Effects of aromatic ring substitution and of absolute configuration on inhibition of microbial tyramine oxi... J Med Chem. 2004 Nov 18;47(24):5860-71. | |||||
| REF 81 | Quantitative structure-activity relationship and complex network approach to monoamine oxidase A and B inhibitors. J Med Chem. 2008 Nov 13;51(21):6740-51. | |||||
| REF 82 | Inhibition of monoamine oxidase by indole and benzofuran derivatives. Eur J Med Chem. 2010 Oct;45(10):4458-66. | |||||
| REF 83 | Synthesis and evaluation of 6-methyl-3-phenylcoumarins as potent and selective MAO-B inhibitors. Bioorg Med Chem Lett. 2009 Sep 1;19(17):5053-5. | |||||
| REF 84 | Multiple, small dose administration of (-)deprenyl enhances catecholaminergic activity and diminishes serotoninergic activity in the brain and these effects are unrelated to MAO-B inhibition. Arch Int Pharmacodyn Ther. 1994 Jul-Aug;328(1):1-15. | |||||
| REF 85 | Chromone-2- and -3-carboxylic acids inhibit differently monoamine oxidases A and B. Bioorg Med Chem Lett. 2010 May 1;20(9):2709-12. | |||||
| REF 86 | Identification of novel monoamine oxidase B inhibitors by structure-based virtual screening. Bioorg Med Chem Lett. 2010 Sep 1;20(17):5295-8. | |||||
| REF 87 | Structures of human monoamine oxidase B complexes with selective noncovalent inhibitors: safinamide and coumarin analogs. J Med Chem. 2007 Nov 15;50(23):5848-52. | |||||
| REF 88 | Inhibition of monoamine oxidase by 8-benzyloxycaffeine analogues. Bioorg Med Chem. 2010 Feb;18(3):1018-28. | |||||
| REF 89 | New halogenated 3-phenylcoumarins as potent and selective MAO-B inhibitors. Bioorg Med Chem Lett. 2010 Sep 1;20(17):5157-60. | |||||
| REF 90 | Differential behavioural and neurochemical effects of para-methoxyamphetamine and 3,4-methylenedioxymethamphetamine in the rat. Prog Neuropsychopharmacol Biol Psychiatry. 2000 Aug;24(6):955-77. | |||||
| REF 91 | Aliphatic propargylamines: potent, selective, irreversible monoamine oxidase B inhibitors. J Med Chem. 1992 Oct 2;35(20):3705-13. | |||||
| REF 92 | Chalcones: a valid scaffold for monoamine oxidases inhibitors. J Med Chem. 2009 May 14;52(9):2818-24. | |||||
| REF 93 | Fluorinated phenylcyclopropylamines. Part 5: Effects of electron-withdrawing or -donating aryl substituents on the inhibition of monoamine oxidases... Bioorg Med Chem. 2008 Aug 1;16(15):7148-66. | |||||
| REF 94 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | |||||
| REF 95 | Inhibition of monoamine oxidase type A, but not type B, is an effective means of inducing anticonvulsant activity in the kindling model of epilepsy. J Pharmacol Exp Ther. 1999 Mar;288(3):984-92. | |||||
| REF 96 | Stereoisomers of allenic amines as inactivators of monoamine oxidase type B. Stereochemical probes of the active site. J Med Chem. 1988 Aug;31(8):1558-66. | |||||
| REF 97 | Synthesis, structure-activity relationships and molecular modeling studies of new indole inhibitors of monoamine oxidases A and B. Bioorg Med Chem. 2008 Nov 15;16(22):9729-40. | |||||
| REF 98 | New pyrrole inhibitors of monoamine oxidase: synthesis, biological evaluation, and structural determinants of MAO-A and MAO-B selectivity. J Med Chem. 2007 Mar 8;50(5):922-31. | |||||
| REF 99 | Interactions of monoamine oxidases with the antiepileptic drug zonisamide: specificity of inhibition and structure of the human monoamine oxidase B complex. J Med Chem. 2011 Feb 10;54(3):909-12. | |||||
| REF 100 | Crystal structures of monoamine oxidase B in complex with four inhibitors of the N-propargylaminoindan class. J Med Chem. 2004 Mar 25;47(7):1767-74. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.