Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T83376
(Former ID: TTDI02202)
|
|||||
| Target Name |
Tumor suppressor candidate 2 (TUSC2)
|
|||||
| Synonyms |
PDGFA-associated protein 2; PDAP2; LGCC; Fusion 1 protein; Fus-1 protein; FUS1; C3orf11
Click to Show/Hide
|
|||||
| Gene Name |
TUSC2
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Lung cancer [ICD-11: 2C25] | |||||
| Function |
May function as a tumor suppressor, inhibiting colony formation, causing G1 arrest and ultimately inducing apoptosis in homozygous 3p21. 3 120-kb region-deficient cells.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MGASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLA
HEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 2 Clinical Trial Drugs | + | ||||
| 1 | CNVN-202 | Drug Info | Phase 1/2 | Non-small-cell lung cancer | [3] | |
| 2 | Fus-1 tumor suppressor gene therapy | Drug Info | Phase 1/2 | Non-small-cell lung cancer | [3] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Suppressor | [+] 2 Suppressor drugs | + | ||||
| 1 | CNVN-202 | Drug Info | [4] | |||
| 2 | Fus-1 tumor suppressor gene therapy | Drug Info | [1] | |||
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
|
There is no similarity protein (E value < 0.005) for this target
|
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| WikiPathways | [+] 3 WikiPathways | + | ||||
| 1 | miR-targeted genes in muscle cell - TarBase | |||||
| 2 | miR-targeted genes in lymphocytes - TarBase | |||||
| 3 | miR-targeted genes in leukocytes - TarBase | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | INGN 201: Ad-p53, Ad5CMV-p53, adenoviral p53, p53 gene therapy--introgen, RPR/INGN 201. Drugs R D. 2007;8(3):176-87. | |||||
| REF 2 | ClinicalTrials.gov (NCT04486833) TUSC2-nanoparticles (GPX-001) and Osimertinib in Patients With Stage IV Lung Cancer Who Progressed on Osimertinib Alone. U.S. National Institutes of Health. | |||||
| REF 3 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018766) | |||||
| REF 4 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018766) | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.