Target Information

Target General Information

Top

Target ID

T86679 (Former ID: TTDS00188)

Target Name

Adenosine A2b receptor (ADORA2B)

Synonyms

Adenosine receptor A2b; A2b Adenosine receptor

Click to Show/Hide

Gene Name

ADORA2B

Target Type

Successful target

[1]

Disease

[+] 2 Target-related Diseases

Herpes simplex infection [ICD-11: 1F00]

Supraventricular tachyarrhythmia [ICD-11: BC81]

Function

The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Receptor for adenosine.

Click to Show/Hide

BioChemical Class

GPCR rhodopsin

UniProt ID

AA2BR_HUMAN

Sequence

MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFA
IPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGT
RARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMS
YMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIV
GIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYT
FHKIISRYLLCQADVKSGNGQAGVQPALGVGL

Click to Show/Hide

3D Structure

Click to Show 3D Structure of This Target

AlphaFold

Drugs and Modes of Action

Top

Approved Drug(s)

[+] 2 Approved Drugs

Adenosine

Drug Info

Approved

Paroxysmal supraventricular tachycardia

[2], [3]

Vidarabine

Drug Info

Approved

Herpes simplex virus infection

[4], [5]

Clinical Trial Drug(s)

[+] 6 Clinical Trial Drugs

Tonapofylline

Drug Info

Phase 2

Acute and chronic heart failure

[8]

AB928

Drug Info

Phase 1/2

Metastatic colorectal cancer

[9]

CVT-6883

Drug Info

Phase 1

Asthma

[10], [11]

KF-17837

Drug Info

Phase 1

Parkinson disease

[12]

PBF-1129

Drug Info

Phase 1

Non-small-cell lung cancer

[13]

Xanthine

Drug Info

Phase 1

Apnea

[14], [15]

Discontinued Drug(s)

[+] 2 Discontinued Drugs

PF-1913539

Drug Info

Discontinued in Phase 3

Alzheimer disease

[16]

METHYLTHIOADENOSINE

Drug Info

Terminated

Multiple sclerosis

[20]

Preclinical Drug(s)

[+] 2 Preclinical Drugs

BAY 60-6583

Drug Info

Preclinical

Myocardial ischemia

[17]

LAS-101057

Drug Info

Preclinical

Asthma

[18], [19]

Mode of Action

[+] 4 Modes of Action

Modulator

[+] 3 Modulator drugs

Adenosine

Drug Info

[1]

Vidarabine

Drug Info

[1]

CVT-6883

Drug Info

[11]

Inhibitor

[+] 56 Inhibitor drugs

Tonapofylline

Drug Info

[21]

KF-17837

Drug Info

[22]

METHYLTHIOADENOSINE

Drug Info

[27]

1,3-Diallyl-3,7-dihydro-purine-2,6-dione

Drug Info

[30]

1,3-Diethyl-3,7-dihydro-purine-2,6-dione

Drug Info

[30]

1,3-Dipropyl-3,7-dihydro-purine-2,6-dione

Drug Info

[30]

1-Benzyl-3-methyl-3,7-dihydro-purine-2,6-dione

Drug Info

[31]

1-METHYLXANTHINE

Drug Info

[30]

1-Propyl-3,7-dihydro-purine-2,6-dione

Drug Info

[31]

1H-Imidazo[4,5-c]quinolin-4-ylamine HCl

Drug Info

[32]

2'-Me-tecadenoson

Drug Info

[33]

2,5'-dichloro-5'-deoxy-N6-cyclopentyladenosine

Drug Info

[34]

2,6-diphenyl-8-(1-ethylpropyl)-1-deazapurine

Drug Info

[35]

2-(6-amino-8-bromo-9H-purin-9-yl)ethanol

Drug Info

[36]

2-Amino-4,6-di-furan-2-yl-nicotinonitrile

Drug Info

[37]

2-Amino-4-furan-2-yl-6-phenyl-nicotinonitrile

Drug Info

[37]

2-Cyclopentyl-1H-imidazo[4,5-c]quinolin-4-ylamine

Drug Info

[32]

2-ethyl-4-(thiazol-2-yl)thieno[3,2-d]pyrimidine

Drug Info

[39]

2-Phenyl-1H-imidazo[4,5-c]quinolin-4-ylamine

Drug Info

[32]

3-Methyl-1-phenethyl-3,7-dihydro-purine-2,6-dione

Drug Info

[31]

3-noradamantyl-1,3-dipropylxanthine

Drug Info

[41]

8-(3-Fluoro-phenyl)-9-methyl-9H-purin-6-ylamine

Drug Info

[43]

8-Bromo-9-(2,3-dihydroxypropyl)-9H-adenine

Drug Info

[44]

8-Bromo-9-(2-butyl)-9H-adenine

Drug Info

[44]

8-Bromo-9-(3-hydroxypropyl)-9H-adenine

Drug Info

[44]

8-Bromo-9-cyclobutyl-9H-adenine

Drug Info

[44]

8-Bromo-9-cyclopentyl-9H-adenine

Drug Info

[44]

8-Bromo-9-ethyl-9H-adenine

Drug Info

[44]

8-bromo-9-isobutyl-9H-purin-6-amine

Drug Info

[36]

8-Bromo-9-isopropyl-9H-adenine

Drug Info

[44]

8-Bromo-9-methyl-9H-adenine

Drug Info

[44]

8-Bromo-9-propyl-9H-adenine

Drug Info

[44]

8-Phenyl-1-propyl-3,7-dihydro-purine-2,6-dione

Drug Info

[45]

9-(sec-Butyl)-9H-adenine

Drug Info

[44]

9-Allyl-8-bromo-9H-adenine

Drug Info

[44]

9-Cyclobutyl-9H-adenine

Drug Info

[44]

9-Isopropyl-9H-adenine

Drug Info

[44]

9-Propyl-9H-adenine

Drug Info

[44]

BETA-HYDROXYETHYL THEOPHYLLINE

Drug Info

[36]

CVT-6694

Drug Info

[36]

CVT-7124

Drug Info

[36]

Ethyl 5-benzoyl-4-phenylthiazol-2-ylcarbamate

Drug Info

[21]

GNF-PF-2224

Drug Info

[54]

GNF-PF-2700

Drug Info

[36]

isobutylmethylxanthine

Drug Info

[55]

LUF-5816

Drug Info

[35]

LUF-5978

Drug Info

[35]

N-(2-(furan-2-yl)-3,4'-bipyridin-6-yl)acetamide

Drug Info

[60]

N6-((+/-)-endo-norborn-2-yl)adenosine

Drug Info

[34]

N6-CYCLOPENTYLADENOSINE

Drug Info

[61]

PD-115199

Drug Info

[62]

PSB-0788

Drug Info

[64]

PSB-1115

Drug Info

[64]

PSB-601

Drug Info

[36]

ST-1535

Drug Info

[67]

[3H]CCPA

Drug Info

[33]

Antagonist

[+] 46 Antagonist drugs

AB928

Drug Info

[13]

PBF-1129

Drug Info

[13]

Xanthine

Drug Info

[23]

PF-1913539

Drug Info

[24]

LAS-101057

Drug Info

[26]

(E)-8-(3-chlorostyryl)-caffeine

Drug Info

[28]

3-isobutyl-8-pyrrolidinoxanthine

Drug Info

[40]

4-Ethoxy-7-((E)-styryl)-furo[3,2-g]chromen-5-one

Drug Info

[42]

AS100

Drug Info

[47]

AS70

Drug Info

[47]

AS74

Drug Info

[47]

AS95

Drug Info

[47]

AS96

Drug Info

[47]

AS99

Drug Info

[47]

ATL-801

Drug Info

[28]

ATL-844

Drug Info

[28], [48]

ATL802

Drug Info

[49]

CPFPX

Drug Info

[52]

DEPX

Drug Info

[29]

flavone

Drug Info

[42]

KF 17837S

Drug Info

[53]

KF26777

Drug Info

[56]

MRE 2029F20

Drug Info

[57]

MRE 3008F20

Drug Info

[58]

MRS1041

Drug Info

[42]

MRS1065

Drug Info

[42]

MRS1084

Drug Info

[42]

MRS1086

Drug Info

[42]

MRS1088

Drug Info

[42]

MRS1093

Drug Info

[42]

MRS1132

Drug Info

[42]

MRS1191

Drug Info

[28]

MRS1706

Drug Info

[49]

MRS923

Drug Info

[42]

MRS928

Drug Info

[42]

PSB-10

Drug Info

[65]

PSB-11

Drug Info

[65]

PSB36

Drug Info

[66]

sakuranetin

Drug Info

[42]

visnagin

Drug Info

[42]

VUF5574

Drug Info

[69]

xanthine amine congener

Drug Info

[51], [70]

XCC

Drug Info

[48]

[125I]ABOPX

Drug Info

[29]

[3H]DPCPX

Drug Info

[71]

[3H]OSIP339391

Drug Info

[36], [71]

Agonist

[+] 17 Agonist drugs

BAY 60-6583

Drug Info

[25]

(S)-PIA

Drug Info

[29]

2-chloroadenosine

Drug Info

[38]

AB-MECA

Drug Info

[46]

AB-NECA

Drug Info

[29]

APNEA

Drug Info

[24]

CGS 21680

Drug Info

[50]

CGS 24012

Drug Info

[51]

CV-1674

Drug Info

[24]

CV-1808

Drug Info

[53]

MRS5151

Drug Info

[59]

N(6)-cyclohexyladenosine

Drug Info

[38]

PENECA

Drug Info

[63]

R-N6-(phenylisopropyl)adenosine

Drug Info

[38]

TCPA

Drug Info

[68]

[3H]HEMADO

Drug Info

[72]

[3H]NECA

Drug Info

[46], [61]

Cell-based Target Expression Variations

Top

Cell-based Target Expression Variations

Cell-based Target Expression Variations Info

Different Human System Profiles of Target	Top
Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target. A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020). Human Pathway Affiliation of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function. Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes (Pharmacol Rev, 58: 259-279, 2006). Biological Network Descriptors of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database. The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information (Front Pharmacol, 9, 1245, 2018; Curr Opin Struct Biol. 44:134-142, 2017). Human Similarity Proteins Human Pathway Affiliation Biological Network Descriptors

Different Human System Profiles of Target

Top

Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.

A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020).

Human Pathway Affiliation of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.

Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes (Pharmacol Rev, 58: 259-279, 2006).

Biological Network Descriptors of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.

The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information (Front Pharmacol, 9, 1245, 2018; Curr Opin Struct Biol. 44:134-142, 2017).

Human Similarity Proteins

Human Pathway Affiliation

Biological Network Descriptors

Protein Name	Pfam ID	Percentage of Identity (%)	E value
Olfactory receptor 10A6 (OR10A6)	PF13853	24.204 (76/314)	6.14E-13
Olfactory receptor 11L1 (OR11L1)	PF13853	22.727 (70/308)	4.26E-12
Olfactory receptor 4K3 (OR4K3)	PF13853	25.316 (80/316)	4.31E-12
Olfactory receptor 11H7 (OR11H7)	PF13853	22.756 (71/312)	1.20E-11
Olfactory receptor 4K5 (OR4K5)	PF13853	25.490 (78/306)	1.87E-11
Olfactory receptor 4K15 (OR4K15)	PF13853	26.646 (85/319)	3.72E-11
Olfactory receptor 4D9 (OR4D9)	PF13853	22.293 (70/314)	6.35E-11
Olfactory receptor 10A7 (OR10A7)	PF13853	22.910 (74/323)	6.54E-11
Olfactory receptor 6F1 (OR6F1)	PF13853	35.484 (44/124)	9.11E-11
Olfactory receptor 6C75 (OR6C75)	PF13853	21.382 (65/304)	1.18E-10
Olfactory receptor 1P1 (OR1P1)	PF13853	23.986 (71/296)	1.18E-10
Olfactory receptor 2J2 (OR2J2)	PF13853	24.150 (71/294)	1.35E-10
Olfactory receptor 10G4 (OR10G4)	PF13853	32.203 (38/118)	1.42E-10
Olfactory receptor 51I2 (OR51I2)	PF13853	33.333 (47/141)	2.22E-10
Olfactory receptor 4K2 (OR4K2)	PF13853	31.061 (41/132)	2.46E-10
Olfactory receptor 4K17 (OR4K17)	PF13853	25.228 (83/329)	2.84E-10
Olfactory receptor 2J1 (OR2J1)	PF13853	24.579 (73/297)	3.06E-10
Olfactory receptor 1J1 (OR1J1)	PF13853	30.000 (39/130)	3.67E-10
Putative olfactory receptor 2B3 (OR2B3)	PF13853	21.451 (68/317)	3.98E-10
Putative olfactory receptor 1F12P (OR1F12P)	PF13853	31.206 (44/141)	4.99E-10
Olfactory receptor 6C70 (OR6C70)	PF13853	23.649 (70/296)	6.21E-10
Olfactory receptor 1C1 (OR1C1)	PF13853	24.919 (77/309)	6.46E-10
Olfactory receptor 10G9 (OR10G9)	PF13853	29.688 (38/128)	6.71E-10
Olfactory receptor 12D1 (OR12D1)	PF13853	23.602 (76/322)	7.64E-10
Olfactory receptor 2D2 (OR2D2)	PF13853	23.585 (75/318)	7.86E-10
Olfactory receptor 6S1 (OR6S1)	PF13853	37.410 (52/139)	8.89E-10
Olfactory receptor 2F2 (OR2F2)	PF13853	22.801 (70/307)	9.20E-10
Olfactory receptor 4F17 (OR4F17)	PF13853	25.606 (74/289)	1.57E-09
Olfactory receptor 51V1 (OR51V1)	PF13853	35.780 (39/109)	1.73E-09
Olfactory receptor 4F4 (OR4F4)	PF13853	25.606 (74/289)	1.83E-09
Olfactory receptor 6C65 (OR6C65)	PF13853	32.031 (41/128)	2.67E-09
Olfactory receptor 11G2 (OR11G2)	PF13853	20.833 (65/312)	2.99E-09
Olfactory receptor 51I1 (OR51I1)	PF13853	32.813 (42/128)	3.81E-09
Olfactory receptor 1A2 (OR1A2)	PF13853	22.403 (69/308)	5.98E-09
Olfactory receptor 10A5 (OR10A5)	PF13853	22.571 (72/319)	7.26E-09
Olfactory receptor 1A1 (OR1A1)	PF13853	22.403 (69/308)	8.02E-09
Olfactory receptor 10G7 (OR10G7)	PF13853	31.034 (36/116)	8.24E-09
Olfactory receptor 4L1 (OR4L1)	PF13853	27.206 (37/136)	8.59E-09
Olfactory receptor 4C16 (OR4C16)	PF13853	22.619 (76/336)	8.82E-09
Olfactory receptor 6C3 (OR6C3)	PF13853	20.345 (59/290)	9.19E-09
Olfactory receptor 1J2 (OR1J2)	PF13853	27.820 (37/133)	1.02E-08
Olfactory receptor 4S1 (OR4S1)	PF13853	31.447 (50/159)	1.04E-08
Olfactory receptor 1F1 (OR1F1)	PF13853	30.252 (36/119)	1.09E-08
Olfactory receptor 2W3 (OR2W3)	PF13853	22.034 (65/295)	1.32E-08
Olfactory receptor 6C4 (OR6C4)	PF13853	21.036 (65/309)	1.40E-08
Olfactory receptor 4Q3 (OR4Q3)	PF13853	30.935 (43/139)	1.48E-08
Olfactory receptor 1J4 (OR1J4)	PF13853	21.683 (67/309)	1.56E-08
Olfactory receptor 6C2 (OR6C2)	PF13853	22.973 (68/296)	1.58E-08
Olfactory receptor 10J5 (OR10J5)	PF13853	32.374 (45/139)	1.71E-08
Olfactory receptor 4F5 (OR4F5)	PF13853	25.260 (73/289)	1.80E-08
Olfactory receptor 2F1 (OR2F1)	PF13853	22.186 (69/311)	1.92E-08
Putative olfactory receptor 14L1 (OR14L1P)	PF13853	30.400 (38/125)	1.93E-08
Olfactory receptor 52Z1P (OR52Z1P)	PF13853	36.134 (43/119)	1.96E-08
Olfactory receptor 1N1 (OR1N1)	PF13853	31.159 (43/138)	2.29E-08
Olfactory receptor 8B12 (OR8B12)	PF13853	26.174 (78/298)	2.52E-08
Olfactory receptor 4F3/4F16/4F29 (OR4F3; OR4F16; OR4F29)	PF13853	23.529 (72/306)	2.86E-08
Olfactory receptor 2B11 (OR2B11)	PF13853	25.378 (84/331)	3.11E-08
Olfactory receptor 4N5 (OR4N5)	PF13853	26.875 (43/160)	3.72E-08
Olfactory receptor 3A3 (OR3A3)	PF13853	23.625 (73/309)	3.79E-08
Olfactory receptor 4F15 (OR4F15)	PF13853	23.826 (71/298)	3.82E-08
Olfactory receptor 2A14 (OR2A14)	PF13853	22.150 (68/307)	3.82E-08
Olfactory receptor 10A2 (OR10A2)	PF13853	22.013 (70/318)	4.02E-08
Olfactory receptor 4K13 (OR4K13)	PF13853	31.655 (44/139)	4.19E-08
Olfactory receptor 10C1 (OR10C1)	PF13853	31.429 (44/140)	4.46E-08
Olfactory receptor 7G2 (OR7G2)	PF13853	34.821 (39/112)	5.04E-08
Olfactory receptor 1L1 (OR1L1)	PF13853	31.111 (42/135)	5.07E-08
Putative olfactory receptor 10J6 (OR10J6P)	PF13853	31.783 (41/129)	5.11E-08
Olfactory receptor 9A2 (OR9A2)	PF13853	29.839 (37/124)	5.35E-08
Olfactory receptor 4K1 (OR4K1)	PF13853	31.013 (49/158)	5.53E-08
Olfactory receptor 4F21 (OR4F21)	PF13853	23.667 (71/300)	5.81E-08
Olfactory receptor 10G8 (OR10G8)	PF13853	31.034 (36/116)	5.94E-08
Olfactory receptor 3A1 (OR3A1)	PF13853	24.232 (71/293)	5.99E-08
Olfactory receptor 13A1 (OR13A1)	PF13853	29.825 (34/114)	6.95E-08
Olfactory receptor 6M1 (OR6M1)	PF13853	29.787 (42/141)	7.06E-08
Olfactory receptor 10W1 (OR10W1)	PF13853	23.175 (73/315)	7.07E-08
Olfactory receptor 4C11 (OR4C11)	PF13853	23.171 (76/328)	7.16E-08
Olfactory receptor 10A4 (OR10A4)	PF13853	23.226 (72/310)	7.72E-08
Olfactory receptor 52E8 (OR52E8)	PF13853	34.314 (35/102)	8.07E-08
Olfactory receptor 52I1 (OR52I1)	PF13853	36.000 (36/100)	8.44E-08
Olfactory receptor 14J1 (OR14J1)	PF13853	27.778 (35/126)	9.30E-08
Olfactory receptor 51F1 (OR51F1)	PF13853	32.075 (34/106)	9.75E-08
Olfactory receptor 52I2 (OR52I2)	PF13853	33.654 (35/104)	1.13E-07
Olfactory receptor 9A4 (OR9A4)	PF13853	27.857 (39/140)	1.20E-07
Olfactory receptor 10S1 (OR10S1)	PF13853	24.451 (78/319)	1.25E-07
Olfactory receptor 1D2 (OR1D2)	PF13853	30.579 (37/121)	1.38E-07
Olfactory receptor 52M1 (OR52M1)	PF13853	35.772 (44/123)	1.38E-07
Olfactory receptor 5M10 (OR5M10)	PF13853	22.581 (70/310)	1.39E-07
Olfactory receptor 6N2 (OR6N2)	PF13853	30.769 (36/117)	1.42E-07
Olfactory receptor 1E1 (OR1E1)	PF13853	29.545 (39/132)	1.46E-07
Olfactory receptor 2J3 (OR2J3)	PF13853	23.630 (69/292)	1.67E-07
Olfactory receptor 6N1 (OR6N1)	PF13853	34.951 (36/103)	1.74E-07
Olfactory receptor 5M9 (OR5M9)	PF13853	26.866 (36/134)	1.93E-07
Olfactory receptor 5AS1 (OR5AS1)	PF13853	25.484 (79/310)	2.14E-07
Olfactory receptor 4A15 (OR4A15)	PF13853	29.371 (42/143)	2.37E-07
Olfactory receptor 4M1 (OR4M1)	PF13853	20.973 (69/329)	2.40E-07
Olfactory receptor 52A5 (OR52A5)	PF13853	32.673 (33/101)	2.73E-07
Olfactory receptor 6C68 (OR6C68)	PF13853	22.483 (67/298)	2.92E-07
Olfactory receptor 51A7 (OR51A7)	PF13853	32.110 (35/109)	2.97E-07
Olfactory receptor 4E2 (OR4E2)	PF13853	29.333 (44/150)	3.04E-07
Olfactory receptor 6A2 (OR6A2)	PF13853	30.000 (36/120)	3.08E-07
Olfactory receptor 9A1 (OR9A1P)	PF13853	31.538 (41/130)	3.22E-07
Olfactory receptor 10A3 (OR10A3)	PF13853	23.602 (76/322)	3.28E-07
Olfactory receptor 2A2 (OR2A2)	PF13853	20.968 (65/310)	3.36E-07
Olfactory receptor 1L4 (OR1L4)	PF13853	29.464 (33/112)	3.68E-07
Olfactory receptor 4F6 (OR4F6)	PF13853	24.503 (74/302)	3.69E-07
Olfactory receptor 1M1 (OR1M1)	PF13853	26.950 (38/141)	4.13E-07
Olfactory receptor 2M7 (OR2M7)	PF13853	22.801 (70/307)	4.38E-07
Olfactory receptor 52E2 (OR52E2)	PF13853	31.776 (34/107)	4.39E-07
Olfactory receptor 2T3 (OR2T3)	PF13853	28.671 (41/143)	4.44E-07
Olfactory receptor 4C12 (OR4C12)	PF13853	28.689 (35/122)	4.49E-07
Olfactory receptor 52E4 (OR52E4)	PF13853	27.119 (32/118)	4.63E-07
Olfactory receptor 7D4 (OR7D4)	PF13853	23.794 (74/311)	4.84E-07
Olfactory receptor 10AC1 (OR10AC1)	PF13853	34.307 (47/137)	5.35E-07
Olfactory receptor 10H4 (OR10H4)	PF13853	29.825 (34/114)	5.63E-07
Olfactory receptor 5AL1 (OR5AL1)	PF13853	24.922 (80/321)	6.15E-07
Olfactory receptor 52B6 (OR52B6)	PF13853	37.864 (39/103)	6.21E-07
Olfactory receptor 2T34 (OR2T34)	PF13853	28.671 (41/143)	6.26E-07
Olfactory receptor 1L3 (OR1L3)	PF13853	24.214 (77/318)	6.33E-07
Olfactory receptor 51B2 (OR51B2)	PF13853	33.333 (39/117)	6.35E-07
Olfactory receptor 1L6 (OR1L6)	PF13853	29.464 (33/112)	6.37E-07
Olfactory receptor 8D4 (OR8D4)	PF13853	31.915 (45/141)	7.46E-07
Olfactory receptor 1L8 (OR1L8)	PF13853	31.250 (35/112)	8.24E-07
Olfactory receptor 2AP1 (OR2AP1)	PF13853	23.077 (72/312)	8.54E-07
Olfactory receptor 8B3 (OR8B3)	PF13853	30.657 (42/137)	8.59E-07
Olfactory receptor 14I1 (OR14I1)	PF13853	26.718 (35/131)	8.68E-07
Olfactory receptor 51B5 (OR51B5)	PF13853	33.654 (35/104)	1.01E-06
Olfactory receptor 6V1 (OR6V1)	PF13853	28.571 (38/133)	1.06E-06
Olfactory receptor 51E2 (OR51E2)	PF13853	35.398 (40/113)	1.11E-06
Olfactory receptor 5V1 (OR5V1)	PF13853	22.654 (70/309)	1.14E-06
Olfactory receptor 10J1 (OR10J1)	PF13853	21.795 (68/312)	1.48E-06
Olfactory receptor 14A2 (OR14A2)	PF13853	23.824 (76/319)	1.51E-06
Olfactory receptor 2AT4 (OR2AT4)	PF13853	30.357 (34/112)	1.60E-06
Olfactory receptor 2T4 (OR2T4)	PF13853	23.473 (73/311)	1.79E-06
Olfactory receptor 4D10 (OR4D10)	PF13853	27.273 (39/143)	1.84E-06
Olfactory receptor 7G1 (OR7G1)	PF13853	31.858 (36/113)	1.87E-06
Olfactory receptor 52E5 (OR52E5)	PF13853	30.081 (37/123)	1.88E-06
Putative olfactory receptor 56B2 (OR56B2P)	PF13853	38.235 (39/102)	1.92E-06
Olfactory receptor 2AJ1 (OR2AJ1)	PF13853	24.232 (71/293)	1.92E-06
Olfactory receptor 8K3 (OR8K3)	PF13853	31.538 (41/130)	2.11E-06
Olfactory receptor 52P1 (OR52P1)	PF13853	31.731 (33/104)	2.14E-06
Olfactory receptor 3A2 (OR3A2)	PF13853	30.282 (43/142)	2.17E-06
Olfactory receptor 4C3 (OR4C3)	PF13853	31.618 (43/136)	2.21E-06
Olfactory receptor 5I1 (OR5I1)	PF13853	30.075 (40/133)	2.26E-06
Olfactory receptor 4D2 (OR4D2)	PF13853	27.820 (37/133)	2.31E-06
Olfactory receptor 4E1 (OR4E1)	PF13853	31.683 (32/101)	2.33E-06
Olfactory receptor 6C74 (OR6C74)	PF13853	21.656 (68/314)	2.37E-06
Olfactory receptor 2B6 (OR2B6)	PF13853	20.724 (63/304)	2.45E-06
Olfactory receptor 4K14 (OR4K14)	PF13853	29.286 (41/140)	2.53E-06
Olfactory receptor 51G2 (OR51G2)	PF13853	31.776 (34/107)	2.54E-06
Olfactory receptor 7E24 (OR7E24)	PF13853	30.657 (42/137)	2.62E-06
Olfactory receptor 1N2 (OR1N2)	PF13853	29.008 (38/131)	2.72E-06
Olfactory receptor 51E1 (OR51E1)	PF13853	32.456 (37/114)	2.79E-06
Olfactory receptor 52N2 (OR52N2)	PF13853	33.981 (35/103)	2.80E-06
Olfactory receptor 11H4 (OR11H4)	PF13853	29.252 (43/147)	2.82E-06
Olfactory receptor 5D13 (OR5D13)	PF13853	21.451 (68/317)	3.19E-06
Olfactory receptor 1Q1 (OR1Q1)	PF13853	29.060 (34/117)	3.25E-06
Olfactory receptor 6C76 (OR6C76)	PF13853	20.761 (60/289)	3.25E-06
Olfactory receptor 1G1 (OR1G1)	PF13853	28.030 (37/132)	3.51E-06
Olfactory receptor 6C1 (OR6C1)	PF13853	21.192 (64/302)	3.59E-06
Putative olfactory receptor 10D3 (OR10D3)	PF13853	23.762 (72/303)	3.69E-06
Olfactory receptor 2M2 (OR2M2)	PF13853	22.611 (71/314)	3.97E-06
Olfactory receptor 5M11 (OR5M11)	PF13853	33.333 (46/138)	3.98E-06
Olfactory receptor 10X1 (OR10X1)	PF13853	29.508 (36/122)	4.03E-06
Olfactory receptor 4X2 (OR4X2)	PF13853	27.068 (36/133)	4.10E-06
Olfactory receptor 1D4 (OR1D4)	PF13853	28.788 (38/132)	4.14E-06
Olfactory receptor 51F2 (OR51F2)	PF13853	31.818 (35/110)	4.14E-06
Olfactory receptor 7G3 (OR7G3)	PF13853	31.858 (36/113)	4.15E-06
Olfactory receptor 10G6 (OR10G6)	PF13853	31.579 (48/152)	4.21E-06
Olfactory receptor 5M1 (OR5M1)	PF13853	27.344 (35/128)	4.54E-06
Olfactory receptor 8B2 (OR8B2)	PF13853	31.250 (40/128)	5.71E-06
Olfactory receptor 52B2 (OR52B2)	PF13853	32.039 (33/103)	5.78E-06
Olfactory receptor 4D1 (OR4D1)	PF13853	20.779 (64/308)	6.64E-06
Olfactory receptor 52J3 (OR52J3)	PF13853	28.829 (32/111)	6.67E-06
Olfactory receptor 51L1 (OR51L1)	PF13853	25.338 (75/296)	6.81E-06
Olfactory receptor 51T1 (OR51T1)	PF13853	30.189 (32/106)	7.12E-06
Olfactory receptor 52B4 (OR52B4)	PF13853	27.941 (38/136)	7.36E-06
Olfactory receptor 2A25 (OR2A25)	PF13853	28.866 (28/97)	7.54E-06
Olfactory receptor 51S1 (OR51S1)	PF13853	30.909 (34/110)	8.50E-06
Olfactory receptor 52R1 (OR52R1)	PF13853	29.808 (31/104)	8.61E-06
Olfactory receptor 52K2 (OR52K2)	PF13853	34.579 (37/107)	8.89E-06
Olfactory receptor 7A10 (OR7A10)	PF13853	26.515 (35/132)	9.16E-06
Olfactory receptor 52N4 (OR52N4)	PF13853	29.752 (36/121)	9.76E-06
Olfactory receptor 4M2 (OR4M2)	PF13853	21.277 (70/329)	1.06E-05
Olfactory receptor 2M3 (OR2M3)	PF13853	23.127 (71/307)	1.10E-05
Putative olfactory receptor 4A4 (OR4A4P)	PF13853	29.927 (41/137)	1.14E-05
Olfactory receptor 11A1 (OR11A1)	PF13853	29.915 (35/117)	1.15E-05
Olfactory receptor 52A1 (OR52A1)	PF13853	30.769 (32/104)	1.17E-05
Olfactory receptor 8K5 (OR8K5)	PF13853	22.258 (69/310)	1.17E-05
Olfactory receptor 2A12 (OR2A12)	PF13853	20.530 (62/302)	1.19E-05
Olfactory receptor 2A1/2A42 (OR2A1; OR2A42)	PF13853	30.000 (30/100)	1.21E-05
Olfactory receptor 10K2 (OR10K2)	PF13853	21.630 (69/319)	1.27E-05
Olfactory receptor 10K1 (OR10K1)	PF13853	26.619 (37/139)	1.27E-05
Olfactory receptor 8U3 (OR8U3)	PF13853	30.000 (39/130)	1.29E-05
Olfactory receptor 51H1 (OR51H1)	PF13853	31.579 (36/114)	1.34E-05
Olfactory receptor 4A8 (OR4A8)	PF13853	29.710 (41/138)	1.36E-05
Olfactory receptor 6C6 (OR6C6)	PF13853	28.226 (35/124)	1.39E-05
Olfactory receptor 56A4 (OR56A4)	PF13853	24.579 (73/297)	1.49E-05
Olfactory receptor 10H1 (OR10H1)	PF13853	28.205 (33/117)	1.52E-05
Olfactory receptor 52H1 (OR52H1)	PF13853	35.185 (38/108)	1.52E-05
Olfactory receptor 6Q1 (OR6Q1)	PF13853	27.536 (38/138)	1.57E-05
Olfactory receptor 1B1 (OR1B1)	PF13853	21.843 (64/293)	1.64E-05
Olfactory receptor 13C4 (OR13C4)	PF13853	22.910 (74/323)	1.69E-05
Olfactory receptor 11H6 (OR11H6)	PF13853	23.237 (56/241)	1.79E-05
Olfactory receptor 5B3 (OR5B3)	PF13853	23.511 (75/319)	1.79E-05
Olfactory receptor 2T1 (OR2T1)	PF13853	23.509 (67/285)	1.89E-05
Olfactory receptor 2D3 (OR2D3)	PF13853	23.432 (71/303)	2.11E-05
Olfactory receptor 11H2 (OR11H2)	PF13853	28.244 (37/131)	2.12E-05
Olfactory receptor 1E2 (OR1E2)	PF13853	27.660 (39/141)	2.22E-05
Olfactory receptor 51D1 (OR51D1)	PF13853	31.068 (32/103)	2.31E-05
Olfactory receptor 1D5 (OR1D5)	PF13853	28.448 (33/116)	2.35E-05
Olfactory receptor 5K2 (OR5K2)	PF13853	31.624 (37/117)	2.40E-05
Olfactory receptor 4N2 (OR4N2)	PF13853	25.625 (41/160)	2.47E-05
Olfactory receptor 2G6 (OR2G6)	PF13853	25.478 (80/314)	2.54E-05
Olfactory receptor 5AR1 (OR5AR1)	PF13853	19.874 (63/317)	2.54E-05
Olfactory receptor 4C15 (OR4C15)	PF13853	23.739 (80/337)	2.58E-05
Olfactory receptor 5M3 (OR5M3)	PF13853	29.730 (33/111)	2.88E-05
Olfactory receptor 2M5 (OR2M5)	PF13853	22.150 (68/307)	3.11E-05
Olfactory receptor 2T7 (OR2T7)	PF13853	20.767 (65/313)	3.30E-05
Olfactory receptor 7A17 (OR7A17)	PF13853	28.788 (38/132)	3.31E-05
Olfactory receptor 2T2 (OR2T2)	PF13853	21.795 (68/312)	3.33E-05
Olfactory receptor 5B2 (OR5B2)	PF13853	22.360 (72/322)	3.56E-05
Olfactory receptor 6X1 (OR6X1)	PF13853	28.571 (38/133)	3.72E-05
Olfactory receptor 2T35 (OR2T35)	PF13853	22.115 (69/312)	3.91E-05
Olfactory receptor 4A5 (OR4A5)	PF13853	31.852 (43/135)	4.49E-05
Olfactory receptor 7A5 (OR7A5)	PF13853	30.556 (33/108)	4.62E-05
Olfactory receptor 9G4 (OR9G4)	PF13853	23.841 (72/302)	4.68E-05
Olfactory receptor 11H1 (OR11H1)	PF13853	28.226 (35/124)	4.75E-05
Olfactory receptor 8G1 (OR8G1)	PF13853	23.077 (72/312)	4.90E-05
Olfactory receptor 4C13 (OR4C13)	PF13853	27.215 (43/158)	5.01E-05
Olfactory receptor 5M8 (OR5M8)	PF13853	29.197 (40/137)	5.41E-05
Olfactory receptor 10Q1 (OR10Q1)	PF13853	23.154 (69/298)	5.53E-05
Olfactory receptor 5F1 (OR5F1)	PF13853	33.607 (41/122)	5.60E-05
Olfactory receptor 8J2 (OR8J2)	PF13853	29.839 (37/124)	6.20E-05
Olfactory receptor 8B4 (OR8B4)	PF13853	23.684 (72/304)	6.26E-05
Olfactory receptor 10H2 (OR10H2)	PF13853	31.959 (31/97)	6.31E-05
Olfactory receptor 4C6 (OR4C6)	PF13853	30.841 (33/107)	6.55E-05
Olfactory receptor 51G1 (OR51G1)	PF13853	33.333 (34/102)	6.65E-05
Putative olfactory receptor 1F2 (OR1F2P)	PF13853	28.696 (33/115)	7.10E-05
Olfactory receptor 10G3 (OR10G3)	PF13853	30.159 (38/126)	7.25E-05
Olfactory receptor 52K1 (OR52K1)	PF13853	31.068 (32/103)	7.60E-05
Olfactory receptor 10J3 (OR10J3)	PF13853	29.204 (33/113)	7.83E-05
Olfactory receptor 4A47 (OR4A47)	PF13853	29.104 (39/134)	7.98E-05
Olfactory receptor 5P3 (OR5P3)	PF13853	30.693 (31/101)	8.03E-05
Putative olfactory receptor 10D4 (OR10D4P)	PF13853	27.737 (38/137)	8.08E-05
Olfactory receptor 11H12 (OR11H12)	PF13853	28.226 (35/124)	8.81E-05
Olfactory receptor 8A1 (OR8A1)	PF13853	27.200 (34/125)	8.89E-05
Putative olfactory receptor 7A2 (OR7A2P)	PF13853	25.000 (33/132)	9.57E-05
Olfactory receptor 6K3 (OR6K3)	PF13853	28.814 (34/118)	9.92E-05
Olfactory receptor 14A16 (OR14A16)	PF13853	28.000 (35/125)	1.07E-04
Olfactory receptor 6B1 (OR6B1)	PF13853	29.134 (37/127)	1.08E-04
Olfactory receptor 4S2 (OR4S2)	PF13853	22.476 (69/307)	1.13E-04
Olfactory receptor 5K1 (OR5K1)	PF13853	29.915 (35/117)	1.17E-04
Olfactory receptor 52D1 (OR52D1)	PF13853	32.039 (33/103)	1.19E-04
Olfactory receptor 51A4 (OR51A4)	PF13853	24.684 (78/316)	1.21E-04
Olfactory receptor 8H1 (OR8H1)	PF13853	27.586 (32/116)	1.21E-04
Putative olfactory receptor 5AK3 (OR5AK3P)	PF13853	27.407 (37/135)	1.23E-04
Olfactory receptor 7C2 (OR7C2)	PF13853	21.587 (68/315)	1.24E-04
Olfactory receptor 13G1 (OR13G1)	PF13853	30.556 (33/108)	1.26E-04
Olfactory receptor 2T10 (OR2T10)	PF13853	22.819 (68/298)	1.27E-04
Olfactory receptor 56A3 (OR56A3)	PF13853	22.148 (66/298)	1.29E-04
Olfactory receptor 8J1 (OR8J1)	PF13853	22.222 (68/306)	1.31E-04
Putative olfactory receptor 3A4 (OR3A4P)	PF13853	28.099 (34/121)	1.33E-04
Putative olfactory receptor 2W6 (OR2W6P)	PF13853	29.839 (37/124)	1.34E-04
Olfactory receptor 13D1 (OR13D1)	PF13853	28.986 (40/138)	1.36E-04
Olfactory receptor 13C3 (OR13C3)	PF13853	28.906 (37/128)	1.37E-04
Olfactory receptor 1S2 (OR1S2)	PF13853	27.536 (38/138)	1.39E-04
Olfactory receptor 2C1 (OR2C1)	PF13853	29.412 (30/102)	1.43E-04
Olfactory receptor 8H2 (OR8H2)	PF13853	28.571 (38/133)	1.45E-04
Olfactory receptor 4M2 (OR4M2B)	PF13853	20.973 (69/329)	1.52E-04
Olfactory receptor 56A1 (OR56A1)	PF13853	29.808 (31/104)	1.66E-04
Olfactory receptor 1K1 (OR1K1)	PF13853	21.429 (60/280)	1.85E-04
Olfactory receptor 6K6 (OR6K6)	PF13853	30.435 (42/138)	1.88E-04
Olfactory receptor 8H3 (OR8H3)	PF13853	29.851 (40/134)	1.97E-04
Olfactory receptor 2T33 (OR2T33)	PF13853	25.373 (51/201)	2.07E-04
Olfactory receptor 12D3 (OR12D3)	PF13853	24.444 (33/135)	2.10E-04
Olfactory receptor 2B2 (OR2B2)	PF13853	20.598 (62/301)	2.12E-04
Olfactory receptor 5B21 (OR5B21)	PF13853	22.000 (66/300)	2.14E-04
Olfactory receptor 10V1 (OR10V1)	PF13853	27.966 (33/118)	2.24E-04
Olfactory receptor 4D5 (OR4D5)	PF13853	29.286 (41/140)	2.33E-04
Olfactory receptor 10P1 (OR10P1)	PF13853	28.571 (32/112)	2.49E-04
Olfactory receptor 5B12 (OR5B12)	PF13853	30.579 (37/121)	2.52E-04
Olfactory receptor 4D11 (OR4D11)	PF13853	25.180 (35/139)	2.55E-04
Olfactory receptor 52A4 (OR52A4P)	PF13853	29.167 (28/96)	2.57E-04
Olfactory receptor 2T27 (OR2T27)	PF13853	21.019 (66/314)	2.59E-04
Olfactory receptor 10H5 (OR10H5)	PF13853	30.928 (30/97)	2.60E-04
Olfactory receptor 13J1 (OR13J1)	PF13853	28.947 (33/114)	2.65E-04
Olfactory receptor 52E1 (OR52E1)	PF13853	31.200 (39/125)	2.94E-04
Olfactory receptor 6T1 (OR6T1)	PF13853	32.836 (22/67)	2.95E-04
Olfactory receptor 4B1 (OR4B1)	PF13853	20.395 (62/304)	3.00E-04
Olfactory receptor 51B6 (OR51B6)	PF13853	30.252 (36/119)	3.28E-04
Olfactory receptor 1I1 (OR1I1)	PF13853	32.990 (32/97)	3.47E-04
Olfactory receptor 2AE1 (OR2AE1)	PF13853	30.556 (33/108)	3.55E-04
Olfactory receptor 2AG2 (OR2AG2)	PF13853	20.513 (64/312)	3.56E-04
Putative olfactory receptor 8G2 (OR8G2P)	PF13853	28.037 (30/107)	3.81E-04
Olfactory receptor 56A5 (OR56A5)	PF13853	30.435 (35/115)	3.86E-04
Olfactory receptor 8J3 (OR8J3)	PF13853	26.429 (37/140)	3.92E-04
Olfactory receptor 13C8 (OR13C8)	PF13853	26.364 (29/110)	3.93E-04
Olfactory receptor 8G5 (OR8G5)	PF13853	28.148 (38/135)	4.42E-04
Olfactory receptor 5AP2 (OR5AP2)	PF13853	22.540 (71/315)	4.57E-04
Olfactory receptor 6K2 (OR6K2)	PF13853	31.429 (33/105)	4.62E-04
Olfactory receptor 6P1 (OR6P1)	PF13853	29.310 (34/116)	4.79E-04
Olfactory receptor 8B8 (OR8B8)	PF13853	23.311 (69/296)	4.89E-04
Olfactory receptor 56B4 (OR56B4)	PF13853	33.962 (36/106)	5.03E-04
Olfactory receptor 2T8 (OR2T8)	PF13853	21.895 (67/306)	6.08E-04
Olfactory receptor 5G3 (OR5G3)	PF13853	28.169 (40/142)	6.27E-04
Olfactory receptor 2W1 (OR2W1)	PF13853	21.379 (62/290)	6.96E-04
Olfactory receptor 52E6 (OR52E6)	PF13853	29.412 (30/102)	7.16E-04
Olfactory receptor 6B3 (OR6B3)	PF13853	22.727 (65/286)	7.79E-04
Olfactory receptor 5K4 (OR5K4)	PF13853	27.731 (33/119)	7.90E-04
Olfactory receptor 56B1 (OR56B1)	PF13853	33.600 (42/125)	8.46E-04
Olfactory receptor 6J1 (OR6J1)	PF13853	27.132 (35/129)	8.77E-04
Putative olfactory receptor 52L2 (OR52L2P)	PF13853	29.412 (35/119)	1.00E-03
Olfactory receptor 5B17 (OR5B17)	PF13853	22.785 (72/316)	1.00E-03
Olfactory receptor 8I2 (OR8I2)	PF13853	24.444 (77/315)	1.00E-03
Olfactory receptor 2A5 (OR2A5)	PF13853	26.446 (32/121)	1.00E-03
Olfactory receptor 1S1 (OR1S1)	PF13853	27.536 (38/138)	1.00E-03
Olfactory receptor 10G2 (OR10G2)	PF13853	21.569 (66/306)	1.00E-03
Olfactory receptor 2T12 (OR2T12)	PF13853	20.513 (64/312)	1.00E-03
Click to Show/Hide the Information of Human Similarity Proteins

KEGG Pathway	Pathway ID	Affiliated Target
Rap1 signaling pathway	hsa04015	Affiliated Target
Class: Environmental Information Processing => Signal transduction	Pathway Hierarchy
Calcium signaling pathway	hsa04020	Affiliated Target
Class: Environmental Information Processing => Signal transduction	Pathway Hierarchy
Neuroactive ligand-receptor interaction	hsa04080	Affiliated Target
Class: Environmental Information Processing => Signaling molecules and interaction	Pathway Hierarchy
Vascular smooth muscle contraction	hsa04270	Affiliated Target
Class: Organismal Systems => Circulatory system	Pathway Hierarchy

Degree	1	Degree centrality	1.07E-04	Betweenness centrality	0.00E+00
Closeness centrality	1.78E-01	Radiality	1.29E+01	Clustering coefficient	0.00E+00
Neighborhood connectivity	1.40E+01	Topological coefficient	1.00E+00	Eccentricity	13
Download	Click to Download the Full PPI Network of This Target

Chemical Structure based Activity Landscape of Target

Top

Drug Property Profile of Target

Top

(1) Molecular Weight (mw) based Drug Clustering

(2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering

(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering

(4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering

(5) Rotatable Bond Count (rotbonds) based Drug Clustering

(6) Topological Polar Surface Area (polararea) based Drug Clustering

"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five

Co-Targets

Top

Co-Targets

Co-Targets Info

Target Poor or Non Binders

Top

Target Poor or Non Binders

Target Poor or Non Binders Info

Target Regulators

Top

Target-regulating microRNAs

Target-regulating microRNAs Info

Target Profiles in Patients

Top

Target Expression
Profile (TEP)

Target Expression Profile Info

Target Affiliated Biological Pathways

Top

KEGG Pathway

[+] 5 KEGG Pathways

Rap1 signaling pathway

Calcium signaling pathway

Neuroactive ligand-receptor interaction

Vascular smooth muscle contraction

Alcoholism

NetPath Pathway

[+] 2 NetPath Pathways

TGF_beta_Receptor Signaling Pathway

TCR Signaling Pathway

Pathwhiz Pathway

[+] 1 Pathwhiz Pathways

Intracellular Signalling Through Adenosine Receptor A2b and Adenosine

PID Pathway

[+] 1 PID Pathways

C-MYB transcription factor network

Reactome

[+] 3 Reactome Pathways

Adenosine P1 receptors

G alpha (s) signalling events

Surfactant metabolism

WikiPathways

[+] 4 WikiPathways

Nucleotide GPCRs

GPCRs, Class A Rhodopsin-like

GPCR ligand binding

GPCR downstream signaling

Target-Related Models and Studies

Top

Target Validation

Target Validation Info

References

Top

REF 1

Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.

REF 2

URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2844).

REF 3

Emerging drugs for chemotherapy-induced mucositis. Expert Opin Emerg Drugs. 2008 Sep;13(3):511-22.

REF 4

REF 5

FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 050486.

REF 6

Clinical pipeline report, company report or official report of Klus Pharma

REF 7

Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001363)

REF 8

Emerging drugs for acute and chronic heart failure: current and future developments. Expert Opin Emerg Drugs. 2007 Mar;12(1):75-95.

REF 9

ClinicalTrials.gov (NCT04660812) An Open Label Study Evaluating the Efficacy and Safety of AB928 Based Treatment Combinations in Patients With Metastatic Colorectal Cancer.. U.S. National Institutes of Health.

REF 10

REF 11

GS-6201, a selective blocker of the A2B adenosine receptor, attenuates cardiac remodeling after acute myocardial infarction in the mouse. J Pharmacol Exp Ther. 2012 Dec;343(3):587-95.

REF 12

Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005980)

REF 13

Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)

REF 14

REF 15

Febuxostat (TMX-67), a novel, non-purine, selective inhibitor of xanthine oxidase, is safe and decreases serum urate in healthy volunteers. Nucleosides Nucleotides Nucleic Acids. 2004 Oct;23(8-9):1111-6.

REF 16

Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021875)

REF 17

Circadian rhythm as a therapeutic target. Nat Rev Drug Discov. 2021 Apr;20(4):287-307.

REF 18

REF 19

Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027811)

REF 20

Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000987)

REF 21

2-Amino-5-benzoyl-4-phenylthiazoles: Development of potent and selective adenosine A1 receptor antagonists. Bioorg Med Chem. 2010 Mar 15;18(6):2195-2203.

REF 22

Photoisomerization of a potent and selective adenosine A2 antagonist, (E)-1,3-Dipropyl-8-(3,4-dimethoxystyryl)-7-methylxanthine. J Med Chem. 1993 Nov 12;36(23):3731-3.

REF 23

Role of adenosine in asthma. Drug Dev Res. 1996;39:333-6.

REF 24

Differences in the order of potency for agonists but not antagonists at human and rat adenosine A2A receptors. Biochem Pharmacol. 1999 Jan 1;57(1):65-75.

REF 25

Cardioprotection by ecto-5'-nucleotidase (CD73) and A2B adenosine receptors. Circulation. 2007 Mar 27;115(12):1581-90.

REF 26

Discovery of LAS101057: A Potent, Selective, and Orally Efficacious A2B Adenosine Receptor Antagonist. ACS Med Chem Lett. 2010 Dec 20;2(3):213-8.

REF 27

Novel amino acid derived natural products from the ascidian Atriolum robustum: identification and pharmacological characterization of a unique aden... J Med Chem. 2004 Apr 22;47(9):2243-55.

REF 28

REF 29

Characterization of human A(2B) adenosine receptors: radioligand binding, western blotting, and coupling to G(q) in human embryonic kidney 293 cells and HMC-1 mast cells. Mol Pharmacol. 1999 Oct;56(4):705-13.

REF 30

Benzo[1,2-c:5,4-c']dipyrazoles: non-xanthine adenosine antagonists. J Med Chem. 1988 Oct;31(10):2034-9.

REF 31

Structure-activity relationships at human and rat A2B adenosine receptors of xanthine derivatives substituted at the 1-, 3-, 7-, and 8-positions. J Med Chem. 2002 May 23;45(11):2131-8.

REF 32

1H-imidazo[4,5-c]quinolin-4-amines: novel non-xanthine adenosine antagonists. J Med Chem. 1991 Mar;34(3):1202-6.

REF 33

5'-Carbamoyl derivatives of 2'-C-methyl-purine nucleosides as selective A1 adenosine receptor agonists: affinity, efficacy, and selectivity for A1 ... Bioorg Med Chem. 2008 Jan 1;16(1):336-53.

REF 34

N6-Cycloalkyl- and N6-bicycloalkyl-C5'(C2')-modified adenosine derivatives as high-affinity and selective agonists at the human A1 adenosine recept... J Med Chem. 2009 Apr 23;52(8):2393-406.

REF 35

2,6,8-trisubstituted 1-deazapurines as adenosine receptor antagonists. J Med Chem. 2007 Feb 22;50(4):828-34.

REF 36

Insights into binding modes of adenosine A(2B) antagonists with ligand-based and receptor-based methods. Eur J Med Chem. 2010 Aug;45(8):3459-71.

REF 37

2-Amino-6-furan-2-yl-4-substituted nicotinonitriles as A2A adenosine receptor antagonists. J Med Chem. 2008 Aug 14;51(15):4449-55.

REF 38

Adenosine receptor activation in human fibroblasts: nucleoside agonists and antagonists. Can J Physiol Pharmacol. 1980 Jun;58(6):673-91.

REF 39

Antagonists of the human adenosine A2A receptor. Part 2: Design and synthesis of 4-arylthieno[3,2-d]pyrimidine derivatives. Bioorg Med Chem Lett. 2008 May 1;18(9):2920-3.

REF 40

Inhibition of human mast cell activation with the novel selective adenosine A(2B) receptor antagonist 3-isobutyl-8-pyrrolidinoxanthine (IPDX)(2). Biochem Pharmacol. 2001 Nov 1;62(9):1163-73.

REF 41

Potent and orally bioavailable 8-bicyclo[2.2.2]octylxanthines as adenosine A1 receptor antagonists. J Med Chem. 2006 Nov 30;49(24):7119-31.

REF 42

Synthesis and biological activities of flavonoid derivatives as A3 adenosine receptor antagonists. J Med Chem. 1996 Jun 7;39(12):2293-301.

REF 43

2-Alkynyl-8-aryl-9-methyladenines as novel adenosine receptor antagonists: their synthesis and structure-activity relationships toward hepatic gluc... J Med Chem. 2001 Jan 18;44(2):170-9.

REF 44

8-Bromo-9-alkyl adenine derivatives as tools for developing new adenosine A2A and A2B receptors ligands. Bioorg Med Chem. 2009 Apr 1;17(7):2812-22.

REF 45

Preparation, properties, reactions, and adenosine receptor affinities of sulfophenylxanthine nitrophenyl esters: toward the development of sulfonic... J Med Chem. 2004 Feb 12;47(4):1031-43.

REF 46

Comparative pharmacology of human adenosine receptor subtypes - characterization of stably transfected receptors in CHO cells. Naunyn Schmiedebergs Arch Pharmacol. 1998 Jan;357(1):1-9.

REF 47

Pharmacological characterization of novel adenosine ligands in recombinant and native human A2B receptors. Biochem Pharmacol. 2005 Nov 25;70(11):1601-12.

REF 48

[3H]MRS 1754, a selective antagonist radioligand for A(2B) adenosine receptors. Biochem Pharmacol. 2001 Mar 15;61(6):657-63.

REF 49

Anilide derivatives of an 8-phenylxanthine carboxylic congener are highly potent and selective antagonists at human A(2B) adenosine receptors. J Med Chem. 2000 Mar 23;43(6):1165-72.

REF 50

[3H]CGS 21680, a selective A2 adenosine receptor agonist directly labels A2 receptors in rat brain. J Pharmacol Exp Ther. 1989 Dec;251(3):888-93.

REF 51

Site-directed mutagenesis identifies residues involved in ligand recognition in the human A2a adenosine receptor. J Biol Chem. 1995 Jun 9;270(23):13987-97.

REF 52

Synthesis and evaluation of no-carrier-added 8-cyclopentyl-3-(3-[(18)F]fluoropropyl)-1-propylxanthine ([(18)F]CPFPX): a potent and selective A(1)-adenosine receptor antagonist for in vivo imaging. J Med Chem. 2002 Nov 7;45(23):5150-6.

REF 53

Characterization of human A2A adenosine receptors with the antagonist radioligand [3H]-SCH 58261. Br J Pharmacol. 1997 Jun;121(3):353-60.

REF 54

Discovery of FK453, a novel non-xanthine adenosine A1 receptor antagonist, Bioorg. Med. Chem. Lett. 6(17):2059-2062 (1996).

REF 55

Adenosine receptors: targets for future drugs. J Med Chem. 1982 Mar;25(3):197-207.

REF 56

KF26777 (2-(4-bromophenyl)-7,8-dihydro-4-propyl-1H-imidazo[2,1-i]purin-5(4H)-one dihydrochloride), a new potent and selective adenosine A3 receptor antagonist. Eur J Pharmacol. 2002 May 31;444(3):133-41.

REF 57

Design, synthesis, and biological evaluation of new 8-heterocyclic xanthine derivatives as highly potent and selective human A2B adenosine receptor antagonists. J Med Chem. 2004 Mar 11;47(6):1434-47.

REF 58

Adenosine receptors as therapeutic targets. Nat Rev Drug Discov. 2006 Mar;5(3):247-64.

REF 59

Design of (N)-methanocarba adenosine 5'-uronamides as species-independent A3 receptor-selective agonists. Bioorg Med Chem Lett. 2008 May 1;18(9):2813-9.

REF 60

Discovery of N-(5,6-diarylpyridin-2-yl)amide derivatives as potent and selective A(2B) adenosine receptor antagonists. Bioorg Med Chem Lett. 2010 Mar 1;20(5):1697-700.

REF 61

Adenosine receptor agonists: synthesis and biological evaluation of 1-deaza analogues of adenosine derivatives. J Med Chem. 1988 Jun;31(6):1179-83.

REF 62

(E)-1,3-dialkyl-7-methyl-8-(3,4,5-trimethoxystyryl)xanthines: potent and selective adenosine A2 antagonists. J Med Chem. 1992 Jun 12;35(12):2342-5.

REF 63

N(6)-alkyl-2-alkynyl derivatives of adenosine as potent and selective agonists at the human adenosine A(3) receptor and a starting point for searching A(2B) ligands. J Med Chem. 2002 Jul 18;45(15):3271-9.

REF 64

1-alkyl-8-(piperazine-1-sulfonyl)phenylxanthines: development and characterization of adenosine A2B receptor antagonists and a new radioligand with... J Med Chem. 2009 Jul 9;52(13):3994-4006.

REF 65

Imidazo[2,1-i]purin-5-ones and related tricyclic water-soluble purine derivatives: potent A(2A)- and A(3)-adenosine receptor antagonists. J Med Chem. 2002 Aug 1;45(16):3440-50.

REF 66

Norbornyllactone-substituted xanthines as adenosine A(1) receptor antagonists. Bioorg Med Chem. 2006 Jun 1;14(11):3654-61.

REF 67

2-n-Butyl-9-methyl-8-[1,2,3]triazol-2-yl-9H-purin-6-ylamine and analogues as A2A adenosine receptor antagonists. Design, synthesis, and pharmacolog... J Med Chem. 2005 Nov 3;48(22):6887-96.

REF 68

Heterologous expression of rat epitope-tagged histamine H2 receptors in insect Sf9 cells. Br J Pharmacol. 1997 Nov;122(5):867-74.

REF 69

A novel class of adenosine A3 receptor ligands. 1. 3-(2-Pyridinyl)isoquinoline derivatives. J Med Chem. 1998 Oct 8;41(21):3987-93.

REF 70

Use of the triazolotriazine [3H]ZM 241385 as a radioligand at recombinant human A2B adenosine receptors. Drug Des Discov. 1999 Nov;16(3):217-26.

REF 71

[3H]OSIP339391, a selective, novel, and high affinity antagonist radioligand for adenosine A2B receptors. Biochem Pharmacol. 2004 Jul 15;68(2):305-12.

REF 72

[3H]HEMADO--a novel tritiated agonist selective for the human adenosine A3 receptor. Eur J Pharmacol. 2007 Feb 5;556(1-3):14-8.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Prof. Yuzong CHEN

Prof. Feng ZHU