Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T92072
(Former ID: TTDS00186)
|
|||||
Target Name |
Adenosine A1 receptor (ADORA1)
|
|||||
Synonyms |
Adenosine receptor A1; A(1) adenosine receptor
Click to Show/Hide
|
|||||
Gene Name |
ADORA1
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Orthostatic hypotension [ICD-11: BA21] | |||||
Function |
The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase. Receptor for adenosine.
Click to Show/Hide
|
|||||
BioChemical Class |
GPCR rhodopsin
|
|||||
UniProt ID | ||||||
Sequence |
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL KIWNDHFRCQPAPPIDEDLPEERPDD Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
ADReCS ID | BADD_A01328 ; BADD_A01334 | |||||
HIT2.0 ID | T35LKG |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
1 | Caffeine | Drug Info | Approved | Orthostatic hypotension | [2], [3] | |
Clinical Trial Drug(s) | [+] 10 Clinical Trial Drugs | + | ||||
1 | AMP-579 | Drug Info | Phase 2 | Hyperlipidaemia | [6] | |
2 | Apaxifylline | Drug Info | Phase 2 | Cognitive impairment | [7] | |
3 | BAY 1067197 | Drug Info | Phase 2 | Heart failure | [8] | |
4 | Capadenoson | Drug Info | Phase 2 | Atrial fibrillation | [9] | |
5 | DTI-0009 | Drug Info | Phase 2 | Atrial fibrillation | [10] | |
6 | SELODENOSON | Drug Info | Phase 2 | Cardiac arrhythmias | [10] | |
7 | SLV320 | Drug Info | Phase 2 | Heart failure | [11], [12] | |
8 | Tonapofylline | Drug Info | Phase 2 | Acute and chronic heart failure | [13] | |
9 | INO-8875 | Drug Info | Phase 1/2 | Glaucoma/ocular hypertension | [14] | |
10 | KF-17837 | Drug Info | Phase 1 | Parkinson disease | [18] | |
Discontinued Drug(s) | [+] 9 Discontinued Drugs | + | ||||
1 | CVT-124 | Drug Info | Discontinued in Phase 3 | Autoimmune diabetes | [19] | |
2 | N-0861 | Drug Info | Discontinued in Phase 3 | Cardiac disease | [20] | |
3 | Tecadenoson | Drug Info | Discontinued in Phase 3 | Cardiac arrhythmias | [21], [22] | |
4 | BRL-61063 | Drug Info | Discontinued in Phase 2 | Allergy | [24] | |
5 | FK-352 | Drug Info | Discontinued in Phase 2 | Hypertension | [25] | |
6 | FK-453 | Drug Info | Discontinued in Phase 2 | Renal failure | [26], [27] | |
7 | FK-838 | Drug Info | Discontinued in Phase 2 | Hypertension | [28] | |
8 | SDZ-WAG-994 | Drug Info | Discontinued in Phase 1 | Hypertension | [31] | |
9 | METHYLTHIOADENOSINE | Drug Info | Terminated | Multiple sclerosis | [33] | |
Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
1 | BAY 60-6583 | Drug Info | Preclinical | Myocardial ischemia | [32] | |
Mode of Action | [+] 4 Modes of Action | + | ||||
Antagonist | [+] 37 Antagonist drugs | + | ||||
1 | Caffeine | Drug Info | [1], [34] | |||
2 | Apaxifylline | Drug Info | [36] | |||
3 | SLV320 | Drug Info | [12] | |||
4 | CVT-124 | Drug Info | [48], [49] | |||
5 | N-0861 | Drug Info | [50] | |||
6 | FK-352 | Drug Info | [52] | |||
7 | (E)-8-(3-chlorostyryl)-caffeine | Drug Info | [61] | |||
8 | 4-Ethoxy-7-((E)-styryl)-furo[3,2-g]chromen-5-one | Drug Info | [90] | |||
9 | 8-cyclopentyltheophylline | Drug Info | [96] | |||
10 | AS100 | Drug Info | [101] | |||
11 | AS70 | Drug Info | [101] | |||
12 | AS99 | Drug Info | [101] | |||
13 | ATL802 | Drug Info | [102] | |||
14 | CPFPX | Drug Info | [104] | |||
15 | flavone | Drug Info | [90] | |||
16 | FR194921 | Drug Info | [108] | |||
17 | isobutylmethylxanthine | Drug Info | [114], [115] | |||
18 | KF26777 | Drug Info | [116] | |||
19 | MRE 2029F20 | Drug Info | [120] | |||
20 | MRE 3008F20 | Drug Info | [103] | |||
21 | MRS1041 | Drug Info | [90] | |||
22 | MRS1062 | Drug Info | [90] | |||
23 | MRS1065 | Drug Info | [90] | |||
24 | MRS1084 | Drug Info | [90] | |||
25 | MRS1086 | Drug Info | [90] | |||
26 | MRS1093 | Drug Info | [90] | |||
27 | MRS1132 | Drug Info | [90] | |||
28 | MRS1191 | Drug Info | [118] | |||
29 | MRS923 | Drug Info | [90] | |||
30 | MRS928 | Drug Info | [90] | |||
31 | PSB-10 | Drug Info | [131] | |||
32 | PSB-11 | Drug Info | [131] | |||
33 | PSB36 | Drug Info | [132] | |||
34 | sakuranetin | Drug Info | [90] | |||
35 | VUF5574 | Drug Info | [137] | |||
36 | xanthine amine congener | Drug Info | [114] | |||
37 | [3H]DPCPX | Drug Info | [138] | |||
Modulator | [+] 6 Modulator drugs | + | ||||
1 | AMP-579 | Drug Info | [35] | |||
2 | BAY 1067197 | Drug Info | [37] | |||
3 | FK-453 | Drug Info | [53] | |||
4 | FK-838 | Drug Info | [54] | |||
5 | L-97-1 intravenous | Drug Info | [118] | |||
6 | Paeoniflorin | Drug Info | [118] | |||
Agonist | [+] 19 Agonist drugs | + | ||||
1 | Capadenoson | Drug Info | [38] | |||
2 | DTI-0009 | Drug Info | [39], [40] | |||
3 | SELODENOSON | Drug Info | [39], [40], [41] | |||
4 | INO-8875 | Drug Info | [44] | |||
5 | PMID27387065-Compound-6 | Drug Info | [47] | |||
6 | Tecadenoson | Drug Info | [48], [49] | |||
7 | SDZ-WAG-994 | Drug Info | [55] | |||
8 | BAY 60-6583 | Drug Info | [56] | |||
9 | (S)-PIA | Drug Info | [62] | |||
10 | 2-chloroadenosine | Drug Info | [84] | |||
11 | 5-Cl-5-deoxy-(+/-)-ENBA | Drug Info | [69] | |||
12 | CP608,039 | Drug Info | [103] | |||
13 | LUF5831 | Drug Info | [119] | |||
14 | MRS5151 | Drug Info | [121] | |||
15 | N(6)-cyclohexyladenosine | Drug Info | [122] | |||
16 | PENECA | Drug Info | [128] | |||
17 | TCPA | Drug Info | [135] | |||
18 | [3H]CCPA | Drug Info | [133], [67] | |||
19 | [3H]HEMADO | Drug Info | [139] | |||
Inhibitor | [+] 205 Inhibitor drugs | + | ||||
1 | Tonapofylline | Drug Info | [42], [43] | |||
2 | KF-17837 | Drug Info | [45] | |||
3 | SCH-442416 | Drug Info | [46] | |||
4 | BRL-61063 | Drug Info | [51] | |||
5 | ARISTEROMYCIN | Drug Info | [57] | |||
6 | METHYLTHIOADENOSINE | Drug Info | [58] | |||
7 | METRIFUDIL | Drug Info | [59] | |||
8 | (1-Phenyl-propyl)-(9-phenyl-9H-purin-6-yl)-amine | Drug Info | [60] | |||
9 | (9-Methyl-9H-purin-6-yl)-phenyl-amine | Drug Info | [60] | |||
10 | 1,3-Diallyl-3,7-dihydro-purine-2,6-dione | Drug Info | [63] | |||
11 | 1,3-Diethyl-3,7-dihydro-purine-2,6-dione | Drug Info | [63] | |||
12 | 1,3-Diisobutyl-3,7-dihydro-purine-2,6-dione | Drug Info | [63] | |||
13 | 1,3-Dipropyl-3,7-dihydro-purine-2,6-dione | Drug Info | [63] | |||
14 | 1-Methyl-8-phenyl-3,7-dihydro-purine-2,6-dione | Drug Info | [64] | |||
15 | 1-METHYLXANTHINE | Drug Info | [63] | |||
16 | 1-Propyl-3,7-dihydro-purine-2,6-dione | Drug Info | [65] | |||
17 | 1H-Imidazo[4,5-c]quinolin-4-ylamine HCl | Drug Info | [66] | |||
18 | 2'-Me-tecadenoson | Drug Info | [67] | |||
19 | 2,4-Dichloro-N-(4-phenyl-thiazol-2-yl)-benzamide | Drug Info | [68] | |||
20 | 2,5'-dichloro-5'-deoxy-N6-cyclopentyladenosine | Drug Info | [69] | |||
21 | 2,6,8-triphenyl-9H-purine | Drug Info | [70] | |||
22 | 2,6-bis(4-tolyl)-9H-purine | Drug Info | [70] | |||
23 | 2,6-dimethyl-8-ethyl-1-deazapurine | Drug Info | [71] | |||
24 | 2,6-diphenyl-1-deazapurine | Drug Info | [71] | |||
25 | 2,6-diphenyl-8-(1-ethylpropyl)-1-deazapurine | Drug Info | [71] | |||
26 | 2,6-diphenyl-8-ethyl-1-deazapurine | Drug Info | [71] | |||
27 | 2,6-diphenyl-8-methyl-1-deazapurine | Drug Info | [71] | |||
28 | 2,6-diphenyl-8-tButyl-1-deazapurine | Drug Info | [71] | |||
29 | 2,6-diphenyl-9H-purine | Drug Info | [70] | |||
30 | 2,6-Diphenyl-pyrimidin-4-ylamine | Drug Info | [72] | |||
31 | 2,6-dphenyl-8-propyl-1-deazapurine | Drug Info | [71] | |||
32 | 2-(1H-benzo[d]imidazol-2-yl)quinoxaline | Drug Info | [73] | |||
33 | 2-(2''-indolylethyloxy)adenosine | Drug Info | [74] | |||
34 | 2-(2-furyl)-6-(1H-pyrazol-1-yl)pyrimidin-4-amine | Drug Info | [75] | |||
35 | 2-(3''(5''-chloro-indolyl)ethyloxy)adenosine | Drug Info | [74] | |||
36 | 2-(3''(7''-bromo-indolyl)ethyloxy)adenosine | Drug Info | [74] | |||
37 | 2-(3''-(4''-bromo-indolyl)ethyloxy)adenosine | Drug Info | [74] | |||
38 | 2-(3''-(5''-bromo-indolyl)ethyloxy)adenosine | Drug Info | [74] | |||
39 | 2-(3''-(5''-fluoro-indolyl)ethyloxy)adenosine | Drug Info | [74] | |||
40 | 2-(3''-(5''-hydroxyindolyl)ethyloxy)adenosine | Drug Info | [74] | |||
41 | 2-(3''-(5''-iodo-indolyl)ethyloxy)adenosine | Drug Info | [74] | |||
42 | 2-(3''-(5''-methoxy-indolyl)ethyloxy)adenosine | Drug Info | [74] | |||
43 | 2-(3''-(6''-bromo-indolyl)ethyloxy)adenosine | Drug Info | [74] | |||
44 | 2-(3''-(6''-chloro-indolyl)ethyloxy)adenosine | Drug Info | [74] | |||
45 | 2-(3''-indolylethyloxy)adenosine | Drug Info | [74] | |||
46 | 2-(3''-pyrrolylethyloxy)adenosine | Drug Info | [74] | |||
47 | 2-(4-chloro-1H-benzo[d]imidazol-2-yl)quinoxaline | Drug Info | [76] | |||
48 | 2-(4-chlorophenyl)-6-phenyl-9H-purine | Drug Info | [70] | |||
49 | 2-(4-ethylthiobenzimidazol-2-yl)quinoxaline | Drug Info | [76] | |||
50 | 2-(4-hydroxypent-1-yl)-N6-methoxyadenosine | Drug Info | [77] | |||
51 | 2-(4-methoxyphenyl)-6-phenyl-9H-purine | Drug Info | [70] | |||
52 | 2-(4-methyl-1H-benzo[d]imidazol-2-yl)quinoxaline | Drug Info | [73] | |||
53 | 2-(5-cyano-1-pent-1-ynyl)-N6-methoxyadenosine | Drug Info | [77] | |||
54 | 2-(6-amino-8-bromo-9H-purin-9-yl)ethanol | Drug Info | [78] | |||
55 | 2-(6-Cyclopentylamino-purin-9-yl)-ethanol | Drug Info | [60] | |||
56 | 2-(hex-1-ynyl)-N6-methoxyadenosine | Drug Info | [77] | |||
57 | 2-Amino-4,6-di-furan-2-yl-nicotinonitrile | Drug Info | [79] | |||
58 | 2-Amino-4,6-di-thiophen-2-yl-nicotinonitrile | Drug Info | [79] | |||
59 | 2-Amino-4,6-diphenyl-nicotinonitrile | Drug Info | [79] | |||
60 | 2-Amino-4,6-diphenyl-pyrimidin-5-carbonitrile | Drug Info | [72] | |||
61 | 2-Amino-4,6-diphenyl-pyrimidine | Drug Info | [72] | |||
62 | 2-Amino-4-furan-2-yl-6-phenyl-nicotinonitrile | Drug Info | [79] | |||
63 | 2-Amino-4-phenyl-6-thiophen-2-yl-nicotinonitrile | Drug Info | [79] | |||
64 | 2-amino-6-phenyl-4-p-tolylnicotinonitrile | Drug Info | [80] | |||
65 | 2-Amino-6-phenyl-4-thiophen-2-yl-nicotinonitrile | Drug Info | [79] | |||
66 | 2-amino-N-benzyl-6-phenyl-9H-purine-9-carboxamide | Drug Info | [81] | |||
67 | 2-azido-N6-methyl-9-(beta-D-ribofuranosyl)adenine | Drug Info | [82] | |||
68 | 2-chloro-4-(thiophen-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [83] | |||
69 | 2-Cyclopentyl-1H-imidazo[4,5-c]quinolin-4-ylamine | Drug Info | [66] | |||
70 | 2-ethyl-4-(furan-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [83] | |||
71 | 2-ethyl-4-(pyridin-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [83] | |||
72 | 2-ethyl-4-(thiazol-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [83] | |||
73 | 2-ethyl-4-(thiophen-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [83] | |||
74 | 2-ethynyl-N6-methoxyadenosine | Drug Info | [77] | |||
75 | 2-m-tolyl-2H-pyrazolo[3,4-c]quinolin-4(5H)-one | Drug Info | [85] | |||
76 | 2-m-tolyl-2H-pyrazolo[3,4-c]quinolin-4-amine | Drug Info | [85] | |||
77 | 2-p-tolyl-2H-pyrazolo[3,4-c]quinolin-4(5H)-one | Drug Info | [85] | |||
78 | 2-p-tolyl-2H-pyrazolo[3,4-c]quinolin-4-amine | Drug Info | [85] | |||
79 | 2-Phenyl-1H-imidazo[4,5-c]quinolin-4-ylamine | Drug Info | [66] | |||
80 | 2-phenyl-2H-pyrazolo[3,4-c]quinolin-4(5H)-one | Drug Info | [85] | |||
81 | 2-phenyl-2H-pyrazolo[3,4-c]quinolin-4-amine | Drug Info | [85] | |||
82 | 2-phenylpropoxyadenosine | Drug Info | [74] | |||
83 | 2-tolyl-6-phenyl-9H-purine | Drug Info | [70] | |||
84 | 2-[(4-acetylphenyl)ethynyl]-N6-methoxyadenosine | Drug Info | [77] | |||
85 | 2-[(4-fluorophenyl)ethynyl]-N6-methoxyadenosine | Drug Info | [77] | |||
86 | 3,4-Dichloro-N-(4-phenyl-thiazol-2-yl)-benzamide | Drug Info | [68] | |||
87 | 3-(3-chloro-1H-pyrazol-5-yl)quinoxalin-2(1H)-one | Drug Info | [73] | |||
88 | 3-Benzyl-7-methyl-[1,8]naphthyridin-4-ol | Drug Info | [86] | |||
89 | 3-Benzyl-7-methyl-[1,8]naphthyridine-4-thiol | Drug Info | [86] | |||
90 | 3-noradamantyl-1,3-dipropylxanthine | Drug Info | [87] | |||
91 | 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [88] | |||
92 | 4-(ethylthio)-6-phenyl-1,3,5-triazin-2-amine | Drug Info | [80] | |||
93 | 4-(furan-2-yl)thieno[3,2-d]pyrimidin-2-amine | Drug Info | [81] | |||
94 | 4-(thiazol-2-yl)thieno[3,2-d]pyrimidin-2-amine | Drug Info | [83] | |||
95 | 4-Amino-2,6-diphenyl-pyrimidine-5-carbonitrile | Drug Info | [72] | |||
96 | 4-Bromo-N-(4-phenyl-thiazol-2-yl)-benzamide | Drug Info | [68] | |||
97 | 4-Chloro-7-methyl-2-phenyl-[1,8]naphthyridine | Drug Info | [89] | |||
98 | 4-Chloro-N-(4-phenyl-thiazol-2-yl)-benzamide | Drug Info | [68] | |||
99 | 4-Methoxy-N-(3-phenyl-isoquinolin-1-yl)-benzamide | Drug Info | [68] | |||
100 | 4-Nitro-N-(4-phenyl-thiazol-2-yl)-benzamide | Drug Info | [68] | |||
101 | 4-tert-Butyl-N-(4-phenyl-thiazol-2-yl)-benzamide | Drug Info | [68] | |||
102 | 5,7-dibromo-9H-pyrido[3,4-b]indol-6-ol | Drug Info | [91] | |||
103 | 6-(furan-2-yl)-9H-purin-2-amine | Drug Info | [92] | |||
104 | 6-ethylamino-2-(3''-indolyl)ethyloxy)adenosine | Drug Info | [74] | |||
105 | 6-guanidino-2-(3''-indolylethyloxy)adenosine | Drug Info | [74] | |||
106 | 7-(3,6,9,12-tetraoxatricos-22-enyl)theophylline | Drug Info | [93] | |||
107 | 7-Bromo-2-phenyl-[1,8]naphthyridin-4-ol | Drug Info | [94] | |||
108 | 7-Chloro-2-phenyl-[1,8]naphthyridin-4-ol | Drug Info | [94] | |||
109 | 7-Dimethylamino-2-phenyl-[1,8]naphthyridin-4-ol | Drug Info | [94] | |||
110 | 7-Methyl-2-propyl-[1,8]naphthyridin-4-ol | Drug Info | [94] | |||
111 | 8-Bromo-9-(2,3-dihydroxypropyl)-9H-adenine | Drug Info | [95] | |||
112 | 8-Bromo-9-(2-butyl)-9H-adenine | Drug Info | [95] | |||
113 | 8-Bromo-9-(3-hydroxypropyl)-9H-adenine | Drug Info | [95] | |||
114 | 8-Bromo-9-cyclobutyl-9H-adenine | Drug Info | [95] | |||
115 | 8-Bromo-9-cyclohexyl-9H-adenine | Drug Info | [95] | |||
116 | 8-Bromo-9-cyclopentyl-9H-adenine | Drug Info | [95] | |||
117 | 8-Bromo-9-ethyl-9H-adenine | Drug Info | [95] | |||
118 | 8-bromo-9-isobutyl-9H-purin-6-amine | Drug Info | [78] | |||
119 | 8-Bromo-9-isopropyl-9H-adenine | Drug Info | [95] | |||
120 | 8-Bromo-9-methyl-9H-adenine | Drug Info | [95] | |||
121 | 8-Bromo-9-phenylethyl-9H-adenine | Drug Info | [95] | |||
122 | 8-Bromo-9-propyl-9H-adenine | Drug Info | [95] | |||
123 | 8-cyclohexyl-6-(4-tolyl)-2-phenyl-9H-purine | Drug Info | [70] | |||
124 | 8-Phenyl-1-propyl-3,7-dihydro-purine-2,6-dione | Drug Info | [97] | |||
125 | 8-Phenyl-3,7-dihydro-purine-2,6-dione | Drug Info | [97] | |||
126 | 9-(3-aminobenzyl)-6-(furan-2-yl)-9H-purin-2-amine | Drug Info | [81] | |||
127 | 9-(3-nitrobenzyl)-6-(furan-2-yl)-9H-purin-2-amine | Drug Info | [81] | |||
128 | 9-(4-nitrobenzyl)-6-(furan-2-yl)-9H-purin-2-amine | Drug Info | [81] | |||
129 | 9-Allyl-8-bromo-9H-adenine | Drug Info | [95] | |||
130 | 9-benzyl-6-(furan-2-yl)-9H-purin-2-amine | Drug Info | [81] | |||
131 | 9-Benzyl-8-bromo-9H-adenine | Drug Info | [95] | |||
132 | 9-Cyclobutyl-9H-adenine | Drug Info | [95] | |||
133 | 9-Cyclopentyl-9H-adenine | Drug Info | [60] | |||
134 | 9-Ethyl-8-phenylethynyl-9H-purin-6-ylamine | Drug Info | [98] | |||
135 | 9-Ethyl-9H-adenine | Drug Info | [95] | |||
136 | 9-Isopropyl-9H-adenine | Drug Info | [95] | |||
137 | 9-Methyl-8-[1,2,3]triazol-2-yl-9H-purin-6-ylamine | Drug Info | [99] | |||
138 | 9-Methyl-9H-adenine | Drug Info | [58] | |||
139 | 9-Phenyl-9H-purin-6-ylamine | Drug Info | [60] | |||
140 | 9-Propyl-9H-adenine | Drug Info | [95] | |||
141 | A-987306 | Drug Info | [100] | |||
142 | Cyclohexyl-(2-phenylsulfanyl-9H-purin-6-yl)-amine | Drug Info | [105] | |||
143 | Cyclohexyl-(9-ethyl-9H-purin-6-yl)-amine | Drug Info | [60] | |||
144 | Cyclohexyl-(9-methyl-9H-purin-6-yl)-amine | Drug Info | [60] | |||
145 | Cyclopentyl-(9-cyclopentyl-9H-purin-6-yl)-amine | Drug Info | [60] | |||
146 | Cyclopentyl-(9-ethyl-9H-purin-6-yl)-amine | Drug Info | [60] | |||
147 | Cyclopentyl-(9-methyl-9H-purin-6-yl)-amine | Drug Info | [60] | |||
148 | Cyclopentyl-(9-phenyl-9H-purin-6-yl)-amine | Drug Info | [60] | |||
149 | DEPX | Drug Info | [106] | |||
150 | Ethyl 5-benzoyl-4-phenylthiazol-2-ylcarbamate | Drug Info | [42] | |||
151 | FR-166124 | Drug Info | [107] | |||
152 | GNF-PF-2224 | Drug Info | [109], [110], [111], [112] | |||
153 | GNF-PF-2700 | Drug Info | [78] | |||
154 | Hexanoic Acid (2,6-diphenylpyrimidin-4-yl)amide | Drug Info | [113] | |||
155 | Kuanoniamine D | Drug Info | [117] | |||
156 | LUF-5417 | Drug Info | [42] | |||
157 | LUF-5433 | Drug Info | [42] | |||
158 | LUF-5737 | Drug Info | [113] | |||
159 | LUF-5767 | Drug Info | [113] | |||
160 | LUF-5816 | Drug Info | [71] | |||
161 | LUF-5853 | Drug Info | [72] | |||
162 | LUF-5956 | Drug Info | [70] | |||
163 | LUF-5957 | Drug Info | [70] | |||
164 | LUF-5978 | Drug Info | [71] | |||
165 | N*6*-Cyclohexyl-N*2*-phenyl-9H-purine-2,6-diamine | Drug Info | [105] | |||
166 | N*6*-Cyclooctyl-N*2*-phenyl-9H-purine-2,6-diamine | Drug Info | [105] | |||
167 | N-(2,6-diphenylpyrimidin-4-yl)-3-methylbutyramide | Drug Info | [113] | |||
168 | N-(2,6-diphenylpyrimidin-4-yl)benzamide | Drug Info | [113] | |||
169 | N-(2,6-diphenylpyrimidin-4-yl)butyramide | Drug Info | [113] | |||
170 | N-(2,6-diphenylpyrimidin-4-yl)isobutyramide | Drug Info | [113] | |||
171 | N-(2,6-diphenylpyrimidin-4-yl)propionamide | Drug Info | [113] | |||
172 | N-(2-(furan-2-yl)-3,4'-bipyridin-6-yl)acetamide | Drug Info | [123] | |||
173 | N-(4,5-diphenylpyrimidin-2-yl)acetamide | Drug Info | [113] | |||
174 | N-(4,6-diphenylpyrimidin-2-yl)-3-chlorobenzamide | Drug Info | [113] | |||
175 | N-(4,6-diphenylpyrimidin-2-yl)-3-methylbutyramide | Drug Info | [113] | |||
176 | N-(4,6-diphenylpyrimidin-2-yl)benzamide | Drug Info | [113] | |||
177 | N-(4,6-diphenylpyrimidin-2-yl)propionamide | Drug Info | [113] | |||
178 | N-(4-Phenyl-thiazol-2-yl)-benzamide | Drug Info | [68] | |||
179 | N-(5-Benzoyl-4-phenylthiazol-2-yl)benzamide | Drug Info | [42] | |||
180 | N6-((+/-)-endo-norborn-2-yl)adenosine | Drug Info | [69] | |||
181 | N6-CYCLOPENTYLADENOSINE | Drug Info | [67] | |||
182 | N6-methoxy-2-phenylethynyladenosine | Drug Info | [77] | |||
183 | N6-methoxy-2-[(2-pyridinyl)ethynyl]adenosine | Drug Info | [77] | |||
184 | N6-methoxy-2-[(4-methoxyphenyl)ethynyl]adenosine | Drug Info | [77] | |||
185 | N6-methoxy-2-[(4-methylphenyl)ethynyl]adenosine | Drug Info | [77] | |||
186 | N6-methoxy-2-[(4-pentylphenyl)ethynyl]adenosine | Drug Info | [77] | |||
187 | N6-methoxy-2-[(4-pyridinyl)ethynyl]adenosine | Drug Info | [77] | |||
188 | N6-methoxy-2-[2-(trimethylsilyl)ethynyl]adenosine | Drug Info | [77] | |||
189 | N6-[(4-Amino)-phenyl]-9-benzyl-2-phenyladenine | Drug Info | [124] | |||
190 | N6-[(4-Nitro)-phenyl]-9-benzyl-2-phenyladenine | Drug Info | [124] | |||
191 | P-IODOAMPHETAMINE | Drug Info | [125] | |||
192 | PD-115199 | Drug Info | [126] | |||
193 | PD-81723 | Drug Info | [127] | |||
194 | Pentanoic acid (4,6-diphenylpyrimidin-2-yl)amide | Drug Info | [113] | |||
195 | Phenyl(2-(trifluoromethyl)quinolin-4-yl)methanol | Drug Info | [129] | |||
196 | Phenyl-(9-phenyl-9H-purin-6-yl)-amine | Drug Info | [60] | |||
197 | PSB-0788 | Drug Info | [130] | |||
198 | PSB-1115 | Drug Info | [130] | |||
199 | PSB-601 | Drug Info | [130] | |||
200 | R-N6-(phenylisopropyl)adenosine | Drug Info | [133], [74] | |||
201 | SCH-63390 | Drug Info | [134] | |||
202 | ST-1535 | Drug Info | [99] | |||
203 | VUF-8507 | Drug Info | [136] | |||
204 | [3H]NECA | Drug Info | [140] | |||
205 | [3H]OSIP339391 | Drug Info | [78] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Tissue Distribution
of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues.
The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects
(Nat Rev Drug Discov, 20: 64-81, 2021).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Biological Network Descriptors
of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.
The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information
(Front Pharmacol, 9, 1245, 2018;
Curr Opin Struct Biol. 44:134-142, 2017).
Human Similarity Proteins
Human Tissue Distribution
Human Pathway Affiliation
Biological Network Descriptors
|
Note:
If a protein has TS (tissue specficity) scores at least in one tissue >= 2.5, this protein is called tissue-enriched (including tissue-enriched-but-not-specific and tissue-specific). In the plots, the vertical lines are at thresholds 2.5 and 4.
|
KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
---|---|---|---|
cGMP-PKG signaling pathway | hsa04022 | Affiliated Target |
|
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
cAMP signaling pathway | hsa04024 | Affiliated Target |
|
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Sphingolipid signaling pathway | hsa04071 | Affiliated Target |
|
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Neuroactive ligand-receptor interaction | hsa04080 | Affiliated Target |
|
Class: Environmental Information Processing => Signaling molecules and interaction | Pathway Hierarchy | ||
Regulation of lipolysis in adipocytes | hsa04923 | Affiliated Target |
|
Class: Organismal Systems => Endocrine system | Pathway Hierarchy | ||
Renin secretion | hsa04924 | Affiliated Target |
|
Class: Organismal Systems => Endocrine system | Pathway Hierarchy | ||
Click to Show/Hide the Information of Affiliated Human Pathways |
Degree | 1 | Degree centrality | 1.07E-04 | Betweenness centrality | 0.00E+00 |
---|---|---|---|---|---|
Closeness centrality | 1.84E-01 | Radiality | 1.31E+01 | Clustering coefficient | 0.00E+00 |
Neighborhood connectivity | 1.60E+01 | Topological coefficient | 1.00E+00 | Eccentricity | 12 |
Download | Click to Download the Full PPI Network of This Target | ||||
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 5 KEGG Pathways | + | ||||
1 | cGMP-PKG signaling pathway | |||||
2 | cAMP signaling pathway | |||||
3 | Sphingolipid signaling pathway | |||||
4 | Neuroactive ligand-receptor interaction | |||||
5 | Morphine addiction | |||||
NetPath Pathway | [+] 2 NetPath Pathways | + | ||||
1 | TCR Signaling Pathway | |||||
2 | RANKL Signaling Pathway | |||||
Panther Pathway | [+] 2 Panther Pathways | + | ||||
1 | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | |||||
2 | Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | Adenosine P1 receptors | |||||
2 | G alpha (i) signalling events | |||||
WikiPathways | [+] 4 WikiPathways | + | ||||
1 | Nucleotide GPCRs | |||||
2 | GPCRs, Class A Rhodopsin-like | |||||
3 | GPCR ligand binding | |||||
4 | GPCR downstream signaling |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation | ||||||
Target QSAR Model |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Caffeine as a psychomotor stimulant: mechanism of action. Cell Mol Life Sci. 2004 Apr;61(7-8):857-72. | |||||
REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 407). | |||||
REF 3 | Fatigue: an overview. Am Fam Physician. 2008 Nov 15;78(10):1173-9. | |||||
REF 4 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5604). | |||||
REF 5 | Association between the PDE4D gene and ischaemic stroke in the Chinese Han population. Clin Sci (Lond). 2009 Aug 17;117(7):265-72. | |||||
REF 6 | Recent developments in adenosine receptor ligands and their potential as novel drugs. Biochim Biophys Acta. 2011 May; 1808(5): 1290-1308. | |||||
REF 7 | Xanthines as Adenosine Receptor Antagonists. Handb Exp Pharmacol. 2011; (200): 10.1007/978-3-642-13443-2_6. | |||||
REF 8 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800035637) | |||||
REF 9 | ClinicalTrials.gov (NCT00568945) Study to Investigate the Effect of the A1 Agonist Capadenoson on Ventricular HR in Patients With Persistent or Permanent Atrial Fibrillation.. U.S. National Institutes of Health. | |||||
REF 10 | ClinicalTrials.gov (NCT00040001) Safety and Efficacy Study of an A1-Adenosine Receptor Agonist to Slow Heart Rate in Atrial Fibrillation. U.S. National Institutes of Health. | |||||
REF 11 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3281). | |||||
REF 12 | Role of matrix metalloproteinases and their tissue inhibitors as potential biomarkers of left ventricular remodelling in the athlete's heart. Clin Sci (Lond). 2009 Jul 16;117(4):157-64. | |||||
REF 13 | Emerging drugs for acute and chronic heart failure: current and future developments. Expert Opin Emerg Drugs. 2007 Mar;12(1):75-95. | |||||
REF 14 | ClinicalTrials.gov (NCT01123785) A Dose-Escalation Study Designed to Evaluate the Tolerability, Safety, Pharmacokinetics (PK), and Efficacy of Chronic Topical Ocular Application of INO-8875 in AdultsWith Ocular Hypertension or Primary Open-Angle Glaucoma. U.S. National Institutes of Health. | |||||
REF 15 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5593). | |||||
REF 16 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018030) | |||||
REF 17 | Clinical pipeline report, company report or official report of Astrocyte Pharmaceuticals | |||||
REF 18 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005980) | |||||
REF 19 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015498) | |||||
REF 20 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003285) | |||||
REF 21 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5592). | |||||
REF 22 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010504) | |||||
REF 23 | Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26. | |||||
REF 24 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004678) | |||||
REF 25 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005374) | |||||
REF 26 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5606). | |||||
REF 27 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001559) | |||||
REF 28 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005145) | |||||
REF 29 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3288). | |||||
REF 30 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001436) | |||||
REF 31 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003507) | |||||
REF 32 | Circadian rhythm as a therapeutic target. Nat Rev Drug Discov. 2021 Apr;20(4):287-307. | |||||
REF 33 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000987) | |||||
REF 34 | Adenosine receptor antagonists intensify the benzodiazepine withdrawal signs in mice. Pharmacol Rep. 2006 Sep-Oct;58(5):643-51. | |||||
REF 35 | Adenosine A1/A2a receptor agonist AMP-579 induces acute and delayed preconditioning against in vivo myocardial stunning. Am J Physiol Heart Circ Physiol. 2004 Dec;287(6):H2746-53. | |||||
REF 36 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004779) | |||||
REF 37 | Separation of on-target efficacy from adverse effects through rational design of a bitopic adenosine receptor agonist. Current Issue vol. 111 no. 12 Celine Valant, 4614-4619. | |||||
REF 38 | A1 adenosine receptor agonists and their potential therapeutic applications. Expert Opin Investig Drugs. 2008 Dec;17(12):1901-10. | |||||
REF 39 | Recent developments in adenosine receptor ligands and their potential as novel drugs. Biochim Biophys Acta. 2011 May;1808(5):1290-308. | |||||
REF 40 | International Union of Basic and Clinical Pharmacology. LXXXI. Nomenclature and classification of adenosine receptors--an update. Pharmacol Rev. 2011 Mar;63(1):1-34. | |||||
REF 41 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 42 | 2-Amino-5-benzoyl-4-phenylthiazoles: Development of potent and selective adenosine A1 receptor antagonists. Bioorg Med Chem. 2010 Mar 15;18(6):2195-2203. | |||||
REF 43 | Effects of BG9928, an adenosine A receptor antagonist, in patients with congestive heart failure.J Clin Pharmacol.2011 Jun;51(6):899-907. | |||||
REF 44 | INO-8875, a highly selective A1 adenosine receptor agonist: evaluation of chronotropic, dromotropic, and hemodynamic effects in rats. J Pharmacol Exp Ther. 2013 Jan;344(1):59-67. | |||||
REF 45 | 2-Alkynyl-8-aryl-9-methyladenines as novel adenosine receptor antagonists: their synthesis and structure-activity relationships toward hepatic gluc... J Med Chem. 2001 Jan 18;44(2):170-9. | |||||
REF 46 | Design, radiosynthesis, and biodistribution of a new potent and selective ligand for in vivo imaging of the adenosine A(2A) receptor system using p... J Med Chem. 2000 Nov 16;43(23):4359-62. | |||||
REF 47 | Carbonic anhydrase inhibitors: a review on the progress of patent literature (2011-2016).Expert Opin Ther Pat. 2016 Aug;26(8):947-56. | |||||
REF 48 | CV Therapeutics. Company report from CV Therapeutics, Inc. CV Therapeutics. 2009. | |||||
REF 49 | Adenosine receptors and cardiovascular disease: the adenosine-1 receptor (A1) and A1 selective ligands. Cardiovasc Toxicol. 2003;3(1):71-88. | |||||
REF 50 | N-0861 selectively antagonizes adenosine A1 receptors in vivo. Eur J Pharmacol. 1992 May 27;216(1):9-16. | |||||
REF 51 | Inhibition of cyclic nucleotide phosphodiesterase by derivatives of 1,3-bis(cyclopropylmethyl)xanthine. J Med Chem. 1994 Feb 18;37(4):476-85. | |||||
REF 52 | Adenosine A1 receptor antagonist improves intradialytic hypotension. Kidney Int. 2006 Mar;69(5):877-83. | |||||
REF 53 | Cardiovascular and renal effects of blocking A1 adenosine receptors. J Cardiovasc Pharmacol. 1993 May;21(5):822-8. | |||||
REF 54 | An orally active adenosine A1 receptor antagonist, FK838, increases renal excretion and maintains glomerular filtration rate in furosemide-resistan... Br J Pharmacol. 2003 Aug;139(8):1383-8. | |||||
REF 55 | The cardiac effects of a novel A1-adenosine receptor agonist in guinea pig isolated heart. J Pharmacol Exp Ther. 1994 Dec;271(3):1371-82. | |||||
REF 56 | Protein kinase C protects preconditioned rabbit hearts by increasing sensitivity of adenosine A2b-dependent signaling during early reperfusion. J Mol Cell Cardiol. 2007 Sep;43(3):262-71. | |||||
REF 57 | Methanocarba analogues of purine nucleosides as potent and selective adenosine receptor agonists. J Med Chem. 2000 Jun 1;43(11):2196-203. | |||||
REF 58 | Novel amino acid derived natural products from the ascidian Atriolum robustum: identification and pharmacological characterization of a unique aden... J Med Chem. 2004 Apr 22;47(9):2243-55. | |||||
REF 59 | N-substituted adenosines as novel neuroprotective A(1) agonists with diminished hypotensive effects. J Med Chem. 1999 Sep 9;42(18):3463-77. | |||||
REF 60 | N6,9-disubstituted adenines: potent, selective antagonists at the A1 adenosine receptor. J Med Chem. 1991 Sep;34(9):2877-82. | |||||
REF 61 | Structure-activity relationships of 8-styrylxanthines as A2-selective adenosine antagonists. J Med Chem. 1993 May 14;36(10):1333-42. | |||||
REF 62 | A threonine residue in the seventh transmembrane domain of the human A1 adenosine receptor mediates specific agonist binding. J Biol Chem. 1994 Jan 28;269(4):2373-6. | |||||
REF 63 | Benzo[1,2-c:5,4-c']dipyrazoles: non-xanthine adenosine antagonists. J Med Chem. 1988 Oct;31(10):2034-9. | |||||
REF 64 | Effects of 8-phenyl and 8-cycloalkyl substituents on the activity of mono-, di-, and trisubstituted alkylxanthines with substitution at the 1-, 3-,... J Med Chem. 1989 Jun;32(6):1231-7. | |||||
REF 65 | Structure-activity relationships at human and rat A2B adenosine receptors of xanthine derivatives substituted at the 1-, 3-, 7-, and 8-positions. J Med Chem. 2002 May 23;45(11):2131-8. | |||||
REF 66 | 1H-imidazo[4,5-c]quinolin-4-amines: novel non-xanthine adenosine antagonists. J Med Chem. 1991 Mar;34(3):1202-6. | |||||
REF 67 | 5'-Carbamoyl derivatives of 2'-C-methyl-purine nucleosides as selective A1 adenosine receptor agonists: affinity, efficacy, and selectivity for A1 ... Bioorg Med Chem. 2008 Jan 1;16(1):336-53. | |||||
REF 68 | Substituted 4-phenyl-2-(phenylcarboxamido)-1,3-thiazole derivatives as antagonists for the adenosine A(1) receptor. Bioorg Med Chem Lett. 2001 Aug 6;11(15):2017-9. | |||||
REF 69 | N6-Cycloalkyl- and N6-bicycloalkyl-C5'(C2')-modified adenosine derivatives as high-affinity and selective agonists at the human A1 adenosine recept... J Med Chem. 2009 Apr 23;52(8):2393-406. | |||||
REF 70 | 2,6-disubstituted and 2,6,8-trisubstituted purines as adenosine receptor antagonists. J Med Chem. 2006 May 18;49(10):2861-7. | |||||
REF 71 | 2,6,8-trisubstituted 1-deazapurines as adenosine receptor antagonists. J Med Chem. 2007 Feb 22;50(4):828-34. | |||||
REF 72 | A new generation of adenosine receptor antagonists: from di- to trisubstituted aminopyrimidines. Bioorg Med Chem. 2008 Mar 15;16(6):2741-52. | |||||
REF 73 | Derivatives of 4-amino-6-hydroxy-2-mercaptopyrimidine as novel, potent, and selective A3 adenosine receptor antagonists. J Med Chem. 2008 Mar 27;51(6):1764-70. | |||||
REF 74 | Structure-activity relationships of 2,N(6),5'-substituted adenosine derivatives with potent activity at the A2B adenosine receptor. J Med Chem. 2007 Apr 19;50(8):1810-27. | |||||
REF 75 | Identification of novel, water-soluble, 2-amino-N-pyrimidin-4-yl acetamides as A2A receptor antagonists with in vivo efficacy. J Med Chem. 2008 Feb 14;51(3):400-6. | |||||
REF 76 | 2-(Benzimidazol-2-yl)quinoxalines: a novel class of selective antagonists at human A(1) and A(3) adenosine receptors designed by 3D database search... J Med Chem. 2005 Dec 29;48(26):8253-60. | |||||
REF 77 | N6-methoxy-2-alkynyladenosine derivatives as highly potent and selective ligands at the human A3 adenosine receptor. J Med Chem. 2007 Mar 22;50(6):1222-30. | |||||
REF 78 | Insights into binding modes of adenosine A(2B) antagonists with ligand-based and receptor-based methods. Eur J Med Chem. 2010 Aug;45(8):3459-71. | |||||
REF 79 | 2-Amino-6-furan-2-yl-4-substituted nicotinonitriles as A2A adenosine receptor antagonists. J Med Chem. 2008 Aug 14;51(15):4449-55. | |||||
REF 80 | Identification of non-furan containing A2A antagonists using database mining and molecular similarity approaches. Bioorg Med Chem Lett. 2006 Dec 1;16(23):5993-7. | |||||
REF 81 | Antagonists of the human adenosine A2A receptor. Part 3: Design and synthesis of pyrazolo[3,4-d]pyrimidines, pyrrolo[2,3-d]pyrimidines and 6-arylpu... Bioorg Med Chem Lett. 2008 May 1;18(9):2924-9. | |||||
REF 82 | 2-triazole-substituted adenosines: a new class of selective A3 adenosine receptor agonists, partial agonists, and antagonists. J Med Chem. 2006 Dec 14;49(25):7373-83. | |||||
REF 83 | Antagonists of the human adenosine A2A receptor. Part 2: Design and synthesis of 4-arylthieno[3,2-d]pyrimidine derivatives. Bioorg Med Chem Lett. 2008 May 1;18(9):2920-3. | |||||
REF 84 | Identification of the adenine binding site of the human A1 adenosine receptor. J Biol Chem. 1999 Feb 5;274(6):3617-21. | |||||
REF 85 | New 2-arylpyrazolo[3,4-c]quinoline derivatives as potent and selective human A3 adenosine receptor antagonists. Synthesis, pharmacological evaluati... J Med Chem. 2007 Aug 23;50(17):4061-74. | |||||
REF 86 | 1,8-Naphthyridin-4-one derivatives as new ligands of A2A adenosine receptors. Bioorg Med Chem Lett. 2005 Oct 15;15(20):4604-10. | |||||
REF 87 | Potent and orally bioavailable 8-bicyclo[2.2.2]octylxanthines as adenosine A1 receptor antagonists. J Med Chem. 2006 Nov 30;49(24):7119-31. | |||||
REF 88 | Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97. | |||||
REF 89 | A novel class of highly potent and selective A1 adenosine antagonists: structure-affinity profile of a series of 1,8-naphthyridine derivatives. J Med Chem. 2000 Jul 27;43(15):2814-23. | |||||
REF 90 | Synthesis and biological activities of flavonoid derivatives as A3 adenosine receptor antagonists. J Med Chem. 1996 Jun 7;39(12):2293-301. | |||||
REF 91 | Synthesis of eudistomin D analogues and its effects on adenosine receptors. Bioorg Med Chem. 2008 Apr 1;16(7):3825-30. | |||||
REF 92 | Antagonists of the human A(2A) adenosine receptor. 4. Design, synthesis, and preclinical evaluation of 7-aryltriazolo[4,5-d]pyrimidines. J Med Chem. 2009 Jan 8;52(1):33-47. | |||||
REF 93 | Synthesis of theophylline derivatives and study of their activity as antagonists at adenosine receptors. Bioorg Med Chem. 2010 Mar 15;18(6):2081-2088. | |||||
REF 94 | Study on affinity profile toward native human and bovine adenosine receptors of a series of 1,8-naphthyridine derivatives. J Med Chem. 2004 Jun 3;47(12):3019-31. | |||||
REF 95 | 8-Bromo-9-alkyl adenine derivatives as tools for developing new adenosine A2A and A2B receptors ligands. Bioorg Med Chem. 2009 Apr 1;17(7):2812-22. | |||||
REF 96 | Thermodynamics of full agonist, partial agonist, and antagonist binding to wild-type and mutant adenosine A1 receptors. Biochem Pharmacol. 1998 Dec 1;56(11):1437-45. | |||||
REF 97 | Synthesis of paraxanthine analogs (1,7-disubstituted xanthines) and other xanthines unsubstituted at the 3-position: structure-activity relationshi... J Med Chem. 1993 Oct 29;36(22):3341-9. | |||||
REF 98 | Introduction of alkynyl chains on C-8 of adenosine led to very selective antagonists of the A(3) adenosine receptor. Bioorg Med Chem Lett. 2001 Jul 23;11(14):1931-4. | |||||
REF 99 | 2-n-Butyl-9-methyl-8-[1,2,3]triazol-2-yl-9H-purin-6-ylamine and analogues as A2A adenosine receptor antagonists. Design, synthesis, and pharmacolog... J Med Chem. 2005 Nov 3;48(22):6887-96. | |||||
REF 100 | cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain... J Med Chem. 2008 Nov 27;51(22):7094-8. | |||||
REF 101 | Pharmacological characterization of novel adenosine ligands in recombinant and native human A2B receptors. Biochem Pharmacol. 2005 Nov 25;70(11):1601-12. | |||||
REF 102 | Anilide derivatives of an 8-phenylxanthine carboxylic congener are highly potent and selective antagonists at human A(2B) adenosine receptors. J Med Chem. 2000 Mar 23;43(6):1165-72. | |||||
REF 103 | Adenosine receptors as therapeutic targets. Nat Rev Drug Discov. 2006 Mar;5(3):247-64. | |||||
REF 104 | Synthesis and evaluation of no-carrier-added 8-cyclopentyl-3-(3-[(18)F]fluoropropyl)-1-propylxanthine ([(18)F]CPFPX): a potent and selective A(1)-adenosine receptor antagonist for in vivo imaging. J Med Chem. 2002 Nov 7;45(23):5150-6. | |||||
REF 105 | Reversine and its 2-substituted adenine derivatives as potent and selective A3 adenosine receptor antagonists. J Med Chem. 2005 Jul 28;48(15):4910-8. | |||||
REF 106 | 125I-labeled 8-phenylxanthine derivatives: antagonist radioligands for adenosine A1 receptors. J Med Chem. 1988 Apr;31(4):745-51. | |||||
REF 107 | Discovery of FR166124, a novel water-soluble pyrazolo-[1,5-a]pyridine adenosine A1 receptor antagonist. Bioorg Med Chem Lett. 1999 Jul 19;9(14):1979-84. | |||||
REF 108 | Pharmacological characterization of FR194921, a new potent, selective, and orally active antagonist for central adenosine A1 receptors. J Pharmacol Sci. 2004 Sep;96(1):42-52. | |||||
REF 109 | Minoxidil-induced hair growth is mediated by adenosine in cultured dermal papilla cells: possible involvement of sulfonylurea receptor 2B as a target of minoxidil. J Invest Dermatol. 2001 Dec;117(6):1594-600. | |||||
REF 110 | Influence of the antagonist of adenosine A1 receptors, 8-cyclopentyl-1 ,3-dipropylxanthine, upon the anticonvulsant activity of antiepileptic drugs in mice. Przegl Lek. 2008;65(11):759-63. | |||||
REF 111 | Potent adenosine receptor antagonists that are selective for the A1 receptor subtype. Mol Pharmacol. 1987 Mar;31(3):247-52. | |||||
REF 112 | Synthesis and theoretical studies on energetics of novel N- and O- perfluoroalkyl triazole tagged thienopyrimidines--their potential as adenosine r... Eur J Med Chem. 2010 May;45(5):1739-45. | |||||
REF 113 | 2,4,6-trisubstituted pyrimidines as a new class of selective adenosine A1 receptor antagonists. J Med Chem. 2004 Dec 16;47(26):6529-40. | |||||
REF 114 | Species difference in the G protein selectivity of the human and bovine A1-adenosine receptor. J Biol Chem. 1994 Dec 23;269(51):32077-84. | |||||
REF 115 | Adenosine receptors: targets for future drugs. J Med Chem. 1982 Mar;25(3):197-207. | |||||
REF 116 | KF26777 (2-(4-bromophenyl)-7,8-dihydro-4-propyl-1H-imidazo[2,1-i]purin-5(4H)-one dihydrochloride), a new potent and selective adenosine A3 receptor antagonist. Eur J Pharmacol. 2002 May 31;444(3):133-41. | |||||
REF 117 | Bioactive pyridoacridine alkaloids from the micronesian sponge Oceanapia sp. J Nat Prod. 1998 Feb;61(2):301-5. | |||||
REF 118 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 18). | |||||
REF 119 | Allosteric modulation, thermodynamics and binding to wild-type and mutant (T277A) adenosine A1 receptors of LUF5831, a novel nonadenosine-like agonist. Br J Pharmacol. 2006 Mar;147(5):533-41. | |||||
REF 120 | Design, synthesis, and biological evaluation of new 8-heterocyclic xanthine derivatives as highly potent and selective human A2B adenosine receptor antagonists. J Med Chem. 2004 Mar 11;47(6):1434-47. | |||||
REF 121 | Design of (N)-methanocarba adenosine 5'-uronamides as species-independent A3 receptor-selective agonists. Bioorg Med Chem Lett. 2008 May 1;18(9):2813-9. | |||||
REF 122 | Structure-activity relationships for 2-substituted adenosines at A1 and A2 adenosine receptors. Pharmacology. 1993;46(2):91-100. | |||||
REF 123 | Discovery of N-(5,6-diarylpyridin-2-yl)amide derivatives as potent and selective A(2B) adenosine receptor antagonists. Bioorg Med Chem Lett. 2010 Mar 1;20(5):1697-700. | |||||
REF 124 | N6-1,3-diphenylurea derivatives of 2-phenyl-9-benzyladenines and 8-azaadenines: synthesis and biological evaluation as allosteric modulators of A2A... Eur J Med Chem. 2008 Aug;43(8):1639-47. | |||||
REF 125 | Synthesis and biological activity of N6-(p-sulfophenyl)alkyl and N6-sulfoalkyl derivatives of adenosine: water-soluble and peripherally selective a... J Med Chem. 1992 Oct 30;35(22):4143-9. | |||||
REF 126 | (E)-1,3-dialkyl-7-methyl-8-(3,4,5-trimethoxystyryl)xanthines: potent and selective adenosine A2 antagonists. J Med Chem. 1992 Jun 12;35(12):2342-5. | |||||
REF 127 | Synthesis and biological evaluation of 2-amino-3-(4-chlorobenzoyl)-4-[N-(substituted) piperazin-1-yl]thiophenes as potent allosteric enhancers of t... J Med Chem. 2008 Sep 25;51(18):5875-9. | |||||
REF 128 | N(6)-alkyl-2-alkynyl derivatives of adenosine as potent and selective agonists at the human adenosine A(3) receptor and a starting point for searching A(2B) ligands. J Med Chem. 2002 Jul 18;45(15):3271-9. | |||||
REF 129 | Antagonists of the human adenosine A2A receptor. Part 1: Discovery and synthesis of thieno[3,2-d]pyrimidine-4-methanone derivatives. Bioorg Med Chem Lett. 2008 May 1;18(9):2916-9. | |||||
REF 130 | 1-alkyl-8-(piperazine-1-sulfonyl)phenylxanthines: development and characterization of adenosine A2B receptor antagonists and a new radioligand with... J Med Chem. 2009 Jul 9;52(13):3994-4006. | |||||
REF 131 | 2-Phenylimidazo[2,1-i]purin-5-ones: structure-activity relationships and characterization of potent and selective inverse agonists at Human A3 adenosine receptors. Bioorg Med Chem. 2003 Feb 6;11(3):347-56. | |||||
REF 132 | Antinociceptive effects of novel A2B adenosine receptor antagonists. J Pharmacol Exp Ther. 2004 Jan;308(1):358-66. | |||||
REF 133 | Comparative pharmacology of human adenosine receptor subtypes - characterization of stably transfected receptors in CHO cells. Naunyn Schmiedebergs Arch Pharmacol. 1998 Jan;357(1):1-9. | |||||
REF 134 | Design, synthesis, and biological evaluation of a second generation of pyrazolo[4,3-e]-1,2,4-triazolo[1,5-c]pyrimidines as potent and selective A2A... J Med Chem. 1998 Jun 4;41(12):2126-33. | |||||
REF 135 | N6-cyclopentyl-2-(3-phenylaminocarbonyltriazene-1-yl)adenosine (TCPA), a very selective agonist with high affinity for the human adenosine A1 receptor. J Med Chem. 2003 Apr 10;46(8):1492-503. | |||||
REF 136 | Isoquinoline and quinazoline urea analogues as antagonists for the human adenosine A(3) receptor. J Med Chem. 2000 Jun 1;43(11):2227-38. | |||||
REF 137 | A novel class of adenosine A3 receptor ligands. 1. 3-(2-Pyridinyl)isoquinoline derivatives. J Med Chem. 1998 Oct 8;41(21):3987-93. | |||||
REF 138 | Inhibition of human mast cell activation with the novel selective adenosine A(2B) receptor antagonist 3-isobutyl-8-pyrrolidinoxanthine (IPDX)(2). Biochem Pharmacol. 2001 Nov 1;62(9):1163-73. | |||||
REF 139 | [3H]HEMADO--a novel tritiated agonist selective for the human adenosine A3 receptor. Eur J Pharmacol. 2007 Feb 5;556(1-3):14-8. | |||||
REF 140 | Adenosine receptor agonists: synthesis and biological evaluation of 1-deaza analogues of adenosine derivatives. J Med Chem. 1988 Jun;31(6):1179-83. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.