| Target General Information |
| Target ID |
T35486
|
| Target Name |
GTPase Nras (NRAS) |
| Gene Name |
NRAS |
| Species |
Homo sapiens |
| UniProt ID |
RASN_HUMAN |
| Sequence |
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM [Homo sapiens]
|
| Drug and Corresponding Resistance Mutations |
| Mutation Info |
Missense: G12D |
| Drugs |
| Drug Name |
Dabrafenib |
Drug Info
|
[2] |
| Targeted Disease |
Melanoma |
| Mutation Prevalence |
1 out of 10 patients |
|
| Mutation Info |
Missense: Q61H |
| Drugs |
| Drug Name |
Vemurafenib |
Drug Info
|
[1] |
| Mutation Prevalence |
1 out of 76 patients |
|
| Mutation Info |
Missense: Q61K |
| Drugs |
| Drug Name |
Dabrafenib |
Drug Info
|
[1] |
| Targeted Disease |
Melanoma |
| Mutation Prevalence |
4 out of 76 patients |
|
| Drug Name |
Vemurafenib |
Drug Info
|
[1], [4], [5] |
| Mutation Prevalence |
4 out of 76 patients |
|
| Mutation Info |
Missense: Q61R |
| Drugs |
| Drug Name |
Pembrolizumab |
Drug Info
|
[3] |
| Targeted Disease |
Melanoma |
| Mutation Prevalence |
2 out of 49 patients |
|
| Drug Name |
Vemurafenib |
Drug Info
|
[4], [1] |
| Mutation Prevalence |
3 out of 76 patients |
|
| References |
| REF 1 |
The genetic landscape of clinical resistance to RAF inhibition in metastatic melanoma. Cancer Discov. 2014 Jan;4(1):94-109.
|
| REF 2 |
Increased MAPK reactivation in early resistance to dabrafenib/trametinib combination therapy of BRAF-mutant metastatic melanoma. Nat Commun. 2014 Dec 2;5:5694.
|
| REF 3 |
Circulating tumor DNA to monitor treatment response and detect acquired resistance in patients with metastatic melanoma. Oncotarget. 2015 Dec 8;6(39):42008-18.
|
| REF 4 |
Melanomas acquire resistance to B-RAF(V600E) inhibition by RTK or N-RAS upregulation. Nature. 2010 Dec 16;468(7326):973-7.
|
| REF 5 |
Melanoma patient derived xenografts acquire distinct Vemurafenib resistance mechanisms. Am J Cancer Res. 2015 Mar 15;5(4):1507-18.
|
