| Target General Information |
| Target ID |
T40492
|
| Target Name |
HCV Non-structural protein 5A (NS5A) |
| Gene Name |
NS5A |
| Species |
Hepatitis C virus genotype 1a |
| UniProt ID |
POLG_HCV1(1973-2420) |
| Sequence |
SGSWLRDIWDWICEVLSDFKTWLKAKLMPQLPGIPFVSCQRGYKGVWRVDGIMHTRCHCG
AEITGHVKNGTMRIVGPRTCRNMWSGTFPINAYTTGPCTPLPAPNYTFALWRVSAEEYVE
IRQVGDFHYVTGMTTDNLKCPCQVPSPEFFTELDGVRLHRFAPPCKPLLREEVSFRVGLH
EYPVGSQLPCEPEPDVAVLTSMLTDPSHITAEAAGRRLARGSPPSVASSSASQLSAPSLK
ATCTANHDSPDAELIEANLLWRQEMGGNITRVESENKVVILDSFDPLVAEEDEREISVPA
EILRKSRRFAQALPVWARPDYNPPLVETWKKPDYEPPVVHGCPLPPPKSPPVPPPRKKRT
VVLTESTLSTALAELATRSFGSSSTSGITGDNTTTSSEPAPSGCPPDSDAESYSSMPPLE
GEPGDPDLSDGSWSTVSSEANAEDVVCC [Hepatitis C virus genotype 1a]
|
| Drug and Corresponding Resistance Mutations |
| Mutation Info |
Missense: L31M |
| Drugs |
| Drug Name |
Daclatasvir |
Drug Info
|
[1], [2] |
| Targeted Disease |
HCV infection |
|
| Mutation Info |
Missense: L31V |
| Drugs |
| Drug Name |
Daclatasvir |
Drug Info
|
[1], [2] |
| Targeted Disease |
HCV infection |
|
| Mutation Info |
Missense: L31V + Y93H |
| Drugs |
| Drug Name |
Daclatasvir |
Drug Info
|
[1], [2] |
| Targeted Disease |
HCV infection |
|
| Mutation Info |
Missense: M28T |
| Drugs |
| Drug Name |
Daclatasvir |
Drug Info
|
[1], [2] |
| Targeted Disease |
HCV infection |
|
| Mutation Info |
Missense: M28T + Q30H |
| Drugs |
| Drug Name |
Daclatasvir |
Drug Info
|
[1], [2] |
| Targeted Disease |
HCV infection |
|
| Mutation Info |
Missense: P32L |
| Drugs |
| Drug Name |
Daclatasvir |
Drug Info
|
[1], [2] |
| Targeted Disease |
HCV infection |
|
| Mutation Info |
Missense: Q30E |
| Drugs |
| Drug Name |
Daclatasvir |
Drug Info
|
[1], [2] |
| Targeted Disease |
HCV infection |
|
| Mutation Info |
Missense: Q30H |
| Drugs |
| Drug Name |
Daclatasvir |
Drug Info
|
[1], [2] |
| Targeted Disease |
HCV infection |
|
| Mutation Info |
Missense: Q30R |
| Drugs |
| Drug Name |
Daclatasvir |
Drug Info
|
[1], [2] |
| Targeted Disease |
HCV infection |
|
| Mutation Info |
Missense: Y93C |
| Drugs |
| Drug Name |
Daclatasvir |
Drug Info
|
[1], [2] |
| Targeted Disease |
HCV infection |
|
| Mutation Info |
Missense: Y93H |
| Drugs |
| Drug Name |
Daclatasvir |
Drug Info
|
[1], [2] |
| Targeted Disease |
HCV infection |
|
| Mutation Info |
Missense: Y93N |
| Drugs |
| Drug Name |
Daclatasvir |
Drug Info
|
[1], [2] |
| Targeted Disease |
HCV infection |
|
| References |
| REF 1 |
Chemical genetics strategy identifies an HCV NS5A inhibitor with a potent clinical effect. Nature. 2010 May 6;465(7294):96-100.
|
| REF 2 |
Resistance analysis of the hepatitis C virus NS5A inhibitor BMS-790052 in an in vitro replicon system. Antimicrob Agents Chemother. 2010 Sep;54(9):3641-50.
|
