Target General Information |
Target ID |
T56518
|
Target Name |
HBV Reverse transcriptase |
Species |
Hepatitis B virus genotype B (HBV-B) |
UniProt ID |
DPOL_HBVB5(347-690) |
Sequence |
EDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNTRVSWPK FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSR IINNQHRTMQNLHNSCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLL AQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYAAVTNFLLSLGIHLNPHKT KRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLLGFAAPF TQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQ [Hepatitis B vi rus genotype B (HBV-B)]
|
Drug and Corresponding Resistance Mutations |
Mutation Info |
Missense: A181V |
Drugs |
Drug Name |
Adefovir Dipivoxil |
Drug Info
|
[1], [2] |
Targeted Disease |
HBV infection |
Mutation Prevalence |
843 out of 11751 patients |
|
Mutation Info |
Missense: A194T |
Drugs |
Drug Name |
Tenofovir Disoproxil Fumarate |
Drug Info
|
[3] |
Targeted Disease |
HBV infection |
Mutation Prevalence |
2 out of 317 patients |
|
Mutation Info |
Missense: L180M |
Drugs |
|
Mutation Info |
Missense: M204I |
Drugs |
Drug Name |
Telbivudine |
Drug Info
|
[3] |
Targeted Disease |
HBV infection |
|
Mutation Info |
Missense: M204V |
Drugs |
Drug Name |
Lamivudine |
Drug Info
|
[1] |
Targeted Disease |
HIV infection; HBV infection |
|
Mutation Info |
Missense: M204V/I + A181V |
Drugs |
Drug Name |
Entecavir + Lamivudine + Adefovir |
Drug Info
|
[1] |
Targeted Disease |
HBV infection |
|
Mutation Info |
Missense: M204V/I + M250 |
Drugs |
Drug Name |
Entecavir |
Drug Info
|
[1] |
Targeted Disease |
HBV infection |
|
Mutation Info |
Missense: M204V/I + N236T |
Drugs |
Drug Name |
Entecavir + Lamivudine + Adefovir |
Drug Info
|
[1] |
Targeted Disease |
HBV infection |
|
Mutation Info |
Missense: M204V/I + T184 + S202 |
Drugs |
Drug Name |
Entecavir |
Drug Info
|
[1] |
Targeted Disease |
HBV infection |
Mutation Prevalence |
78 out of 11751 patients |
|
Drug Name |
Adefovir Dipivoxil |
Drug Info
|
[1] |
Targeted Disease |
HBV infection |
|
Mutation Info |
Missense: N236T |
Drugs |
Drug Name |
Adefovir Dipivoxil |
Drug Info
|
[1], [2] |
Targeted Disease |
HBV infection |
Mutation Prevalence |
538 out of 11751 patients |
|
Mutation Info |
Missense: V173L |
Drugs |
|
References |
REF 1 |
Comparison of Detection Rate and Mutational Pattern of Drug-Resistant Mutations Between a Large Cohort of Genotype B and Genotype C Hepatitis B Virus-Infected Patients in North China. Microb Drug Resist. 2017 Jun;23(4):516-522.
|
REF 2 |
Screening and identification of a novel adefovir dipivoxil resistance associated mutation, rtN236V, of HBV from a large cohort of HBV-infected patients. Antivir Ther. 2014;19(6):551-8.
|
REF 3 |
[Drug-resistant mutations in hepatitis B virus found in chronic HBV carriers using PCR sequencing technology]. Zhonghua Gan Zang Bing Za Zhi. 2016 Jan;24(1):36-9.
|
REF 4 |
The hepatitis B virus polymerase mutation rtV173L is selected during lamivudine therapy and enhances viral replication in vitro. J Virol. 2003 Nov;77(21):11833-41.
|