Target General Information |
Target ID |
T91001
|
Target Name |
Bacterial Elongation factor Tu (EF-Tu) |
Gene Name |
EF-Tu |
Species |
Peptoclostridium difficile |
UniProt ID |
EFTU_PEPD6 |
Sequence |
MAKAKYERTKPHVNIGTIGHVDHGKTTLTAAITKTLYDRYQLGEAVDFANIDKAPEERER GITISTAHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSATDGPMPQTREH ILLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLTEYDFPGDDTPIVRGSALMAL EDPKSEWGDKIVELFEQIDEYIPAPERDTDKPFLMPVEDVFSITGRGTVATGRVERGVLK VQDEVELVGLTEAPRKVVVTGVEMFRKLLDQAQAGDNIGALLRGVQRNEIERGQVLAKTG SVKAHTKFTAEVYVLKKEEGGRHTPFFDGYRPQFYFRTTDVTGACKLPEGIEMVMPGDNV TMEVDLINSIVVEEGLRFSIREGGRTVASGVVATIIE [Peptoclostridium diff icile]
|
Drug and Corresponding Resistance Mutations |
Mutation Info |
Missense: A376S |
Drugs |
Drug Name |
Kirromycin |
Drug Info
|
[1] |
Targeted Disease |
Bacterial infection |
|
Mutation Info |
Missense: A376V |
Drugs |
Drug Name |
Kirromycin |
Drug Info
|
[1] |
Targeted Disease |
Bacterial infection |
|
Mutation Info |
Missense: E379K |
Drugs |
Drug Name |
Kirromycin |
Drug Info
|
[1] |
Targeted Disease |
Bacterial infection |
|
Mutation Info |
Missense: G261E |
Drugs |
|
Mutation Info |
Missense: G317D |
Drugs |
Drug Name |
Kirromycin |
Drug Info
|
[1] |
Targeted Disease |
Bacterial infection |
|
Mutation Info |
Missense: L121Q |
Drugs |
Drug Name |
Kirromycin |
Drug Info
|
[1] |
Targeted Disease |
Bacterial infection |
|
Mutation Info |
Missense: Q125E |
Drugs |
Drug Name |
Kirromycin |
Drug Info
|
[1] |
Targeted Disease |
Bacterial infection |
|
Mutation Info |
Missense: Q125K |
Drugs |
Drug Name |
Kirromycin |
Drug Info
|
[1] |
Targeted Disease |
Bacterial infection |
|
Mutation Info |
Missense: Q125R |
Drugs |
Drug Name |
Kirromycin |
Drug Info
|
[1] |
Targeted Disease |
Bacterial infection |
|
Mutation Info |
Missense: R231C |
Drugs |
Drug Name |
Pulvomycin |
Drug Info
|
[1] |
Targeted Disease |
Bacterial infection |
|
Mutation Info |
Missense: R231V |
Drugs |
Drug Name |
Pulvomycin |
Drug Info
|
[1] |
Targeted Disease |
Bacterial infection |
|
Mutation Info |
Missense: R234F |
Drugs |
Drug Name |
Pulvomycin |
Drug Info
|
[1] |
Targeted Disease |
Bacterial infection |
|
Mutation Info |
Missense: R234S |
Drugs |
Drug Name |
Pulvomycin |
Drug Info
|
[1] |
Targeted Disease |
Bacterial infection |
|
Mutation Info |
Missense: R334C |
Drugs |
Drug Name |
Pulvomycin |
Drug Info
|
[1] |
Targeted Disease |
Bacterial infection |
|
Mutation Info |
Missense: T335A |
Drugs |
Drug Name |
Pulvomycin |
Drug Info
|
[1] |
Targeted Disease |
Bacterial infection |
|
Mutation Info |
Missense: Y161C |
Drugs |
Drug Name |
Kirromycin |
Drug Info
|
[1] |
Targeted Disease |
Bacterial infection |
|
Mutation Info |
Missense: Y161D |
Drugs |
Drug Name |
Kirromycin |
Drug Info
|
[1] |
Targeted Disease |
Bacterial infection |
|
Mutation Info |
Missense: Y161N |
Drugs |
Drug Name |
Kirromycin |
Drug Info
|
[1] |
Targeted Disease |
Bacterial infection |
|
References |
REF 1 |
CARD 2017: expansion and model-centric curation of the comprehensive antibiotic resistance database. Nucleic Acids Res. 2017 Jan 4;45(D1):D566-D573.
|
REF 2 |
The comprehensive antibiotic resistance database. Antimicrob Agents Chemother. 2013 Jul;57(7):3348-57.
|