Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T16888
|
||||
Former ID |
TTDI02036
|
||||
Target Name |
Eotaxin ligand
|
||||
Gene Name |
CCL11
|
||||
Synonyms |
CC motif chemokine 11; Eosinophil chemotactic protein; Eotaxin; Smallinducible cytokine A11; CCL11
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Ocular allergy [ICD9: 360-379; ICD10: H00-H59] | ||||
Function |
In response to the presence of allergens, this protein directly promotes the accumulation of eosinophils, a prominent feature of allergic inflammatory reactions. Binds to CCR3.
|
||||
BioChemical Class |
Cytokine: CC chemokine
|
||||
UniProt ID | |||||
Sequence |
MKVSAALLWLLLIAAAFSPQGLAGPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQK
AVIFKTKLAKDICADPKKKWVQDSMKYLDQKSPTPKP |
||||
Drugs and Mode of Action | |||||
References |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.