Target Information

Target General Infomation
Target ID
T13201
Former ID
TTDR01224
Target Name
Carbonic anhydrase I
Gene Name
CA1
Synonyms
CA-I; Carbonate dehydratase I; Carbonic anhydrase B; CA1
Target Type
Successful
Disease Arthritis [ICD9: 710-719; ICD10: M00-M25]
Breast cancer [ICD9: 174, 175; ICD10: C50]
Chronic glaucoma [ICD9: 365; ICD10: H40-H42]
Cancer [ICD9: 140-229; ICD10: C00-C96]
Glaucoma; Duodenal ulcers [ICD9: 365, 531-534; ICD10: H40-H42, K25-K27]
Glaucoma [ICD9: 365; ICD10: H40-H42]
Function
Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea.
BioChemical Class
Carbon-oxygen lyases
Target Validation
T13201
UniProt ID
P00915
EC Number
EC 4.2.1.1
Sequence
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH
VAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNF
DPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAV
PMQHNNRPTQPLKGRTVRASF
Drugs and Mode of Action
Drug(s) Acetazolamide Drug Info Approved Glaucoma [538171], [541873]
Dichlorphenamide Drug Info Approved Chronic glaucoma [538446], [541889]
Ethoxzolamide Drug Info Approved Glaucoma; Duodenal ulcers [538442], [541896]
Methazolamide Drug Info Approved Glaucoma [525219], [541909]
SALICYLATE Drug Info Phase 4 Discovery agent [524105]
CG-100649 Drug Info Phase 3 Arthritis [524183], [543067]
Curcumin Drug Info Phase 3 Cancer [532348], [542031]
PARABEN Drug Info Phase 3 Discovery agent [524059]
PHENOL Drug Info Phase 2/3 Discovery agent [525296]
COUMATE Drug Info Phase 2 Breast cancer [531371]
SULFAMIDE Drug Info Phase 1 Discovery agent [524873]
Inhibitor (2-bromophenyl)difluoromethanesulfonamide Drug Info [527782]
(4-bromophenyl)difluoromethanesulfonamide Drug Info [527782]
1,4-Dihydro-1-methyl-4-oxo-3-pyridinesulfonamide Drug Info [530978]
1-acetamido-5-sulfonamidoindane Drug Info [527262]
1-Benzyl-1,4-dihydro-4-oxo-3-pyridinesulfonamide Drug Info [530978]
1-cyclohexylamido-5-sulfonamidoindane Drug Info [528160]
1-pentafluorophenylamido-5-sulfonamidoindane Drug Info [528160]
1-valproylamido-5-sulfonamidoindane Drug Info [528160]
2,2,2-Trifluoro-N-(4-sulfamoyl-phenyl)-acetamide Drug Info [527743]
2,3-dihydro-1H-indene-5-sulfonamide Drug Info [527262]
2,4-dichloro-5-sulfamoylbenzoic acid Drug Info [530578]
2,4-Disulfamyltrifluoromethylaniline Drug Info [537461]
2-(4-chlorobenzyloxyamino)-N-hydroxyacetamide Drug Info [528653]
2-(4-chlorobenzyloxyamino)-N-hydroxyhexanamide Drug Info [528653]
2-(4-chlorobenzyloxyamino)-N-hydroxypropanamide Drug Info [528653]
2-(biphenyl-4-yl)vinylboronic acid Drug Info [530086]
2-acetamido-5-sulfonamidoindane Drug Info [528160]
2-Acetylamino-indan-5-sulfonic acid hydrate Drug Info [527262]
2-Amino-indan-5-sulfonic acid Drug Info [527262]
2-butylamido-5-sulfonamidoindane Drug Info [528160]
2-cyclohexylamido-5-sulfonamidoindane Drug Info [528160]
2-ethylamido-5-sulfonamidoindane Drug Info [528160]
2-Hydroxycinnamic acid Drug Info [531068]
2-Mercapto-N-(4-sulfamoyl-phenyl)-benzamide Drug Info [529381]
2-Morpholin-4-yl-N-(4-sulfamoyl-phenyl)-acetamide Drug Info [527338]
2-nonylamido-5-sulfonamidoindane Drug Info [528160]
2-oxo-2H-chromene-3-carboxylic acid Drug Info [530514]
2-oxo-2H-thiochromene-3-carboxylic acid Drug Info [530514]
2-pentafluorophenylamido-5-sulfonamidoindane Drug Info [528160]
2-propylamido-5-sulfonamidoindane Drug Info [528160]
2-valproylamido-5-sulfonamidoindane Drug Info [528160]
3-(3-Phenyl-ureido)-benzenesulfonamide Drug Info [527743]
3-(4-sulfamoylphenyl)propanoic acid Drug Info [537461]
3-bromophenyl-difluoromethanesulfonamide Drug Info [527782]
3-Chloro-4-hydrazino-benzenesulfonamide Drug Info [527482]
3-Fluoro-4-hydrazino-benzenesulfonamide Drug Info [527482]
3-mercapto-N-(4-sulfamoyl-phenyl)-propionamide Drug Info [528406]
3-phenyl-5-sulfamoyl-1H-indole-2-carboxamide Drug Info [530132]
3-phenylprop-1-enylboronic acid Drug Info [530086]
3-[4-(AMINOSULFONYL)PHENYL]PROPANOIC ACID Drug Info [551374]
4,4'-thiodipyridine-3-sulfonamide Drug Info [530766]
4,6-Dinitro salicylic acid Drug Info [529721]
4-(2-Amino-ethyl)-benzenesulfonamide Drug Info [527645]
4-(2-aminopyrimidin-4-ylamino)benzenesulfonamide Drug Info [537461]
4-(2-Methyl-8-quinolinoxy)-3-pyridinesulfonamide Drug Info [530766]
4-(2-Phenylacetamido)-3-bromobenzenesulfonamide Drug Info [530219]
4-(2-Phenylacetamido)-3-chlorobenzenesulfonamide Drug Info [530219]
4-(2-Phenylacetamido)-3-fluorobenzenesulfonamide Drug Info [530219]
4-(2-Phenylacetamido)benzenesulfonamide Drug Info [530219]
4-(2-Phenylacetamidoethyl)benzenesulfonamide Drug Info [530219]
4-(2-Phenylacetamidomethyl)benzenesulfonamide Drug Info [530219]
4-(2-Propynylthio)pyridine-3-sulfonamide Drug Info [530766]
4-(2-Pyridin-2-ylacetamido)benzenesulfonamide Drug Info [530219]
4-(2-Pyridin-4-ylacetamido)benzenesulfonamide Drug Info [530219]
4-(4-Cyanophenoxy)-3-pyridinesulfonamide Drug Info [530766]
4-(4-Fluorophenoxy)-3-pyridinesulfonamide Drug Info [530766]
4-(5-Methyl-2-pirazolino)-3-pyridinesulfonamide Drug Info [530766]
4-(Allylamino)-3-pyridinesulfonamide Drug Info [530766]
4-(Carbamolymethylthio)pyridine-3-sulfonamide Drug Info [530766]
4-(Cyanomethylthio)pyridine-3-sulfonamide Drug Info [530766]
4-(hydroxymethyl)benzenesulfonamide Drug Info [537461]
4-(Methylhydrazino)-3-pyridinesulfonamide Drug Info [530766]
4-(N-Oxide-2-pyridylthio)pyridine-3-sulfonamide Drug Info [530766]
4-(Quinolinoxy)-3-pyridinesulfonamide Drug Info [530766]
4-Amino-3-bromo-benzenesulfonamide Drug Info [537461]
4-Amino-3-chloro-benzenesulfonamide Drug Info [537461]
4-Amino-3-fluoro-benzenesulfonamide Drug Info [531031]
4-Amino-3-iodo-benzenesulfonamide Drug Info [537461]
4-amino-6-chlorobenzene-1,3-disulfonamide Drug Info [531031]
4-amino-N-(4-sulfamoylbenzyl)benzenesulfonamide Drug Info [537461]
4-azidobenzenesulfonamide Drug Info [529609]
4-Benzenesulfonylamino-benzenesulfonamide Drug Info [527743]
4-Benzythiopyridine-3-sulfonamide Drug Info [530766]
4-bromophenylboronic acid Drug Info [530086]
4-butylphenylboronic acid Drug Info [530086]
4-Chloro-N-(5-sulfamoyl-indan-2-yl)-benzamide Drug Info [527262]
4-Ethoxy-3-pyridinesulfonamide Drug Info [530766]
4-ethynyl benzene sulfonamide Drug Info [529344]
4-fluoro-N-(4-sulfamoylbenzyl)benzenesulfonamide Drug Info [529884]
4-Hydrazino-3-pyridinesulfonamide Drug Info [530766]
4-Hydrazino-benzenesulfonamide Drug Info [527482]
4-Hydrazinocarbonyl-benzenesulfonamide Drug Info [527482]
4-isothiocyanatobenzenesulfonamide Drug Info [527233]
4-Methanesulfonylamino-benzenesulfonamide Drug Info [527743]
4-Methoxy-3-pyridinesulfonamide Drug Info [530766]
4-methoxyphenylboronic acid Drug Info [530086]
4-methylphenyl-difluoromethanesulfonamide Drug Info [527782]
4-methylstyrylboronic acid Drug Info [530086]
4-Methylthiopyridine-3-sulfonamide Drug Info [530766]
4-nitrophenyl phosphate Drug Info [531156]
4-nitrophenyl-difluoromethanesulfonamide Drug Info [527782]
4-phenoxyphenylboronic acid Drug Info [530086]
4-[2-(2-Thienyl)acetamidoethyl]benzenesulfonamide Drug Info [530219]
4-[2-(2-Thienyl)acetamido]benzenesulfonamide Drug Info [530219]
4-[2-(3-Phenyl-ureido)-ethyl]-benzenesulfonamide Drug Info [527743]
5-amino-1,3,4-thiadiazole-2-sulfonamide Drug Info [531112]
5-Amino-[1,3,4]thiadiazole-2-thiol Drug Info [527519]
5-Chlorosalicylic Acid Drug Info [529721]
5-hydroxy-1-tosyl-1H-pyrrol-2(5H)-one Drug Info [530979]
5-oxo-1-tosyl-2,5-dihydro-1Hpyrrol-2-yl acetate Drug Info [530979]
6-(aminomethyl)-2H-chromen-2-one Drug Info [530514]
6-Amino-benzothiazole-2-sulfonic acid amide Drug Info [525539]
6-Hydroxy-benzothiazole-2-sulfonic acid amide Drug Info [529948]
6-methoxy-2-oxo-2H-chromene-3-carboxylic acid Drug Info [530514]
6-methyl-2-oxo-2H-chromene-3-carboxylic acid Drug Info [530514]
7-methoxy-2-oxo-2H-chromene-4-carboxylic acid Drug Info [530514]
8-methoxy-2-oxo-2H-chromene-3-carboxylic acid Drug Info [530514]
Aminobenzolamide derivative Drug Info [527261]
Azide Drug Info [527260]
BENZENESULFONAMIDE Drug Info [530046]
BENZOLAMIDE Drug Info [537461]
Benzothiazole-2-sulfonic acid amide Drug Info [527408]
Beta-naphthylboronic acid Drug Info [530086]
Biphenyl-4-ylboronic acid Drug Info [530086]
Carbamoyl phosphate disodium Drug Info [527259]
Carzenide Drug Info [530046]
CATECHIN Drug Info [531068]
CG-100649 Drug Info [533275]
CL-5343 Drug Info [543654]
COUMARIN Drug Info [531259]
COUMATE Drug Info [529605]
Curcumin Drug Info [531068]
CYANATE Drug Info [527260]
Cynooxide anion Drug Info [527211]
Decane-1,10-diyl disulfamate Drug Info [530359]
Decyl sulfamate Drug Info [530359]
ELLAGIC ACID Drug Info [530751]
ETHYL 3-[4-(AMINOSULFONYL)PHENYL]PROPANOATE Drug Info [551374]
FERULIC ACID Drug Info [530751]
GALLICACID Drug Info [530751]
HERNIARIN Drug Info [530514]
Hexane-1,6-diamine Drug Info [530998]
HYDROSULFIDE Drug Info [527260]
IODIDE Drug Info [527231]
N-(4-cyanophenyl)sulfamide Drug Info [527520]
N-(4-Sulfamoyl-phenyl)-benzamide Drug Info [527743]
N-(4-Sulfamoyl-phenyl)-butyramide Drug Info [527743]
N-(4-Sulfamoyl-phenyl)-propionamide Drug Info [527743]
N-(4-sulfamoylphenylethyl)-4-sulfamoylbenzamide Drug Info [551223]
N-(5-ethyl-1,3,4-thiadiazol-2-yl)sulfamide Drug Info [529794]
N-(5-Mercapto-[1,3,4]thiadiazol-2-yl)-acetamide Drug Info [527519]
N-(5-phenyl-1,3,4-thiadiazol-2-yl)sulfamide Drug Info [529794]
N-(5-tert-butyl-1,3,4-thiadiazol-2-yl)sulfamide Drug Info [529794]
N-(pentafluorophenyl)sulfamide Drug Info [527520]
N-1,3,4-thiadiazol-2-ylsulfamide Drug Info [529794]
N-hydroxysulfamide Drug Info [530922]
N-hydroxysulfonamides Drug Info [538135]
N-propynyl amidebenzenesulphonide Drug Info [528491]
N-unsubstituted carbamate esters Drug Info [535861]
N-[4-(trifluoromethyl)phenyl]sulfamide Drug Info [527520]
N-[5-(ethylthio)-1,3,4-thiadiazol-2-yl]sulfamide Drug Info [529794]
N-[5-(methylthio)-1,3,4-thiadiazol-2-yl]sulfamide Drug Info [529794]
N-{2-[4-(AMINOSULFONYL)PHENYL]ETHYL}ACETAMIDE Drug Info [551374]
NITRATE Drug Info [527231]
NSC-654077 Drug Info [529381]
Octane-1,8-diyl disulfamate Drug Info [530359]
Octyl sulfamate Drug Info [530359]
P-Coumaric Acid Drug Info [530751]
PARABEN Drug Info [530751]
PARAOXON Drug Info [531156]
Pentane-1,5-diamine Drug Info [530998]
Pentanoic acid (4-sulfamoyl-phenyl)-amide Drug Info [527743]
Phenethylboronic acid Drug Info [530086]
PHENOL Drug Info [531068]
Phenoxyarsonous acid Drug Info [527231]
Phenyl Boronic acid Drug Info [527231]
PHENYLDIFLUOROMETHANESULFONAMIDE Drug Info [527782]
PHENYLMETHANESULFONAMIDE Drug Info [527782]
PHENYLSULFAMATE Drug Info [527782]
Prop-2-ynyl 4-sulfamoylbenzoate Drug Info [528491]
SACCHARIN Drug Info [531031]
SALICYLATE Drug Info [529562]
Sodium trithiocarbonate Drug Info [530003]
Styrylboronic acid Drug Info [530086]
SULFAMATE Drug Info [527231]
Sulfamic acid 12-sulfamoyloxy-dodecyl ester Drug Info [527391]
Sulfamic acid 16-sulfamoyloxy-hexadecyl ester Drug Info [527391]
Sulfamic acid 3-sulfamoyloxy-phenyl ester Drug Info [527391]
Sulfamic acid 4-sulfamoyloxy-butyl ester Drug Info [527391]
Sulfamic acid 6-sulfamoyloxy-hexyl ester Drug Info [527391]
Sulfamic acid 7-sulfamoyloxy-heptyl ester Drug Info [527391]
SULFAMIDE Drug Info [527231]
Sulfanilamide derivative Drug Info [527560]
SULFATE Drug Info [527231]
Sulfenamido-sulfonamides Drug Info [538055]
Syringic Acid Drug Info [530751]
Thioureido sulfonamide Drug Info [527655]
[Au(CN)2]- Drug Info [527492]
[Cu(CN)2]- Drug Info [527492]
Modulator Acetazolamide Drug Info [556264]
Dichlorphenamide Drug Info [556264]
Ethoxzolamide Drug Info [556264]
L-693612 Drug Info [531635], [533846]
Methazolamide Drug Info [543654]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Nitrogen metabolism
Pathway Interaction Database C-MYB transcription factor network
PathWhiz Pathway Gastric Acid Production
Reactome Erythrocytes take up carbon dioxide and release oxygen
Erythrocytes take up oxygen and release carbon dioxide
Reversible hydration of carbon dioxide
WikiPathways Reversible Hydration of Carbon Dioxide
Uptake of Carbon Dioxide and Release of Oxygen by Erythrocytes
Uptake of Oxygen and Release of Carbon Dioxide by Erythrocytes
References
Ref 524059ClinicalTrials.gov (NCT01688479) Trial Comparing Calendula Officinalis With Aqueous Cream "Essex" to Treat Skin Reactions From Radiotherapy of Breast Cancer. U.S. National Institutes of Health.
Ref 524105ClinicalTrials.gov (NCT01712295) 17% Salicylate Versus 17% Salicylate-Ethyl Pyruvate for Plantar Foot Warts. U.S. National Institutes of Health.
Ref 524183ClinicalTrials.gov (NCT01765296) Phase III Study of CG100649 in Osteoarthritis Patients. U.S. National Institutes of Health.
Ref 524873ClinicalTrials.gov (NCT02216669) Trial to Determine Optimal Phase II Dose of the Oral Dual CAIX Inhibitor/ Radiosensitizer. U.S. National Institutes of Health.
Ref 525219ClinicalTrials.gov (NCT02463357) Three New Ideas to Protect Special Forces From the Stress of High Altitude.
Ref 525296ClinicalTrials.gov (NCT02527187) Determination of the Sensitivity and Specificity of Prick Test Betula Verrucosa.
Ref 531371Irosustat: a first-generation steroid sulfatase inhibitor in breast cancer. Expert Rev Anticancer Ther. 2011 Feb;11(2):179-83.
Ref 532348Nanocurcumin: a promising therapeutic advancement over native curcumin. Crit Rev Ther Drug Carrier Syst. 2013;30(4):331-68.
Ref 538171FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 040195.
Ref 538442FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 011047.
Ref 538446FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 011366.
Ref 541873(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6792).
Ref 541889(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6807).
Ref 541896(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6814).
Ref 541909(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6828).
Ref 542031(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7000).
Ref 543067(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8316).
Ref 525539J Med Chem. 1999 Jul 15;42(14):2641-50.Carbonic anhydrase inhibitors. Synthesis of water-soluble, topically effective, intraocular pressure-lowering aromatic/heterocyclic sulfonamides containing cationic or anionic moieties: is the tail more important than the ring?.
Ref 527211Bioorg Med Chem Lett. 2004 Sep 6;14(17):4563-7.Carbonic anhydrase inhibitors. Inhibition of the beta-class enzyme from the methanoarchaeon Methanobacterium thermoautotrophicum (Cab) with anions.
Ref 527231Bioorg Med Chem Lett. 2004 Nov 1;14(21):5435-9.Carbonic anhydrase inhibitors. Inhibition of the newly isolated murine isozyme XIII with anions.
Ref 527233J Med Chem. 2004 Oct 7;47(21):5224-9.Carbonic anhydrase inhibitors: the first on-resin screening of a 4-sulfamoylphenylthiourea library.
Ref 527259Bioorg Med Chem Lett. 2004 Dec 6;14(23):5763-7.Carbonic anhydrase inhibitors. Interaction of isozymes I, II, IV, V, and IX with phosphates, carbamoyl phosphate, and the phosphonate antiviral drug foscarnet.
Ref 527260Bioorg Med Chem Lett. 2004 Dec 6;14(23):5769-73.Carbonic anhydrase inhibitors: inhibition of the membrane-bound human isozyme IV with anions.
Ref 527261Bioorg Med Chem Lett. 2004 Dec 6;14(23):5775-80.Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, and IX with sulfonamides derived from 4-isothiocyanato-benzolamide.
Ref 527262Bioorg Med Chem Lett. 2004 Dec 6;14(23):5781-6.Carbonic anhydrase inhibitors. Design of anticonvulsant sulfonamides incorporating indane moieties.
Ref 527338Bioorg Med Chem Lett. 2005 Jan 17;15(2):367-72.Carbonic anhydrase inhibitors. Novel sulfanilamide/acetazolamide derivatives obtained by the tail approach and their interaction with the cytosolic isozymes I and II, and the tumor-associated isozyme IX.
Ref 527391Bioorg Med Chem Lett. 2005 Feb 1;15(3):579-84.Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, and IX with bis-sulfamates.
Ref 527408Bioorg Med Chem Lett. 2005 Feb 15;15(4):971-6.Carbonic anhydrase inhibitors. Inhibition of the human cytosolic isozyme VII with aromatic and heterocyclic sulfonamides.
Ref 527482J Med Chem. 2005 Mar 24;48(6):2121-5.Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/membrane-associated carbonic anhydrase isozymes I, II, and IX with sulfonamides incorporatinghydrazino moieties.
Ref 527492Bioorg Med Chem Lett. 2005 Apr 1;15(7):1909-13.Carbonic anhydrase inhibitors. Inhibition of isozymes I, II, IV, V and IX with complex fluorides, chlorides and cyanides.
Ref 527519Bioorg Med Chem Lett. 2005 May 2;15(9):2347-52.Carbonic anhydrase inhibitors. Inhibition of the cytosolic and tumor-associated carbonic anhydrase isozymes I, II, and IX with a series of 1,3,4-thiadiazole- and 1,2,4-triazole-thiols.
Ref 527520Bioorg Med Chem Lett. 2005 May 2;15(9):2353-8.Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, IX, and XII with N-hydroxysulfamides--a new zinc-binding function in the design of inhibitors.
Ref 527560Bioorg Med Chem Lett. 2005 Jun 15;15(12):3096-101.Carbonic anhydrase inhibitors. Inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, IX, and XII with Schiff's bases incorporating chromone and aromatic sulfonamide moieties, and their zinc complexes.
Ref 527645J Med Chem. 2005 Jul 28;48(15):4834-41.Carbonic anhydrase inhibitors. Design of fluorescent sulfonamides as probes of tumor-associated carbonic anhydrase IX that inhibit isozyme IX-mediated acidification of hypoxic tumors.
Ref 527655Bioorg Med Chem Lett. 2005 Sep 1;15(17):3821-7.Carbonic anhydrase inhibitors: design of thioureido sulfonamides with potent isozyme II and XII inhibitory properties and intraocular pressure lowering activity in a rabbit model of glaucoma.
Ref 527743Bioorg Med Chem Lett. 2005 Nov 1;15(21):4862-6.Carbonic anhydrase inhibitors: inhibition of the tumor-associated isozymes IX and XII with a library of aromatic and heteroaromatic sulfonamides.
Ref 527782Bioorg Med Chem Lett. 2005 Dec 1;15(23):5192-6. Epub 2005 Oct 3.Carbonic anhydrase inhibitors: inhibition of the human isozymes I, II, VA, and IX with a library of substituted difluoromethanesulfonamides.
Ref 528160J Med Chem. 2006 May 4;49(9):2743-9.Indanesulfonamides as carbonic anhydrase inhibitors. Toward structure-based design of selective inhibitors of the tumor-associated isozyme CA IX.
Ref 528406J Med Chem. 2006 Sep 7;49(18):5544-51.Carbonic anhydrase inhibitors: Hypoxia-activatable sulfonamides incorporating disulfide bonds that target the tumor-associated isoform IX.
Ref 528491J Med Chem. 2006 Nov 2;49(22):6539-48.A novel class of carbonic anhydrase inhibitors: glycoconjugate benzene sulfonamides prepared by "click-tailing".
Ref 528653Bioorg Med Chem. 2007 Mar 15;15(6):2298-311. Epub 2007 Jan 19.Carbonic anhydrase and matrix metalloproteinase inhibitors. Inhibition of human tumor-associated isozymes IX and cytosolic isozyme I andII with sulfonylated hydroxamates.
Ref 529344J Med Chem. 2008 Mar 27;51(6):1945-53. Epub 2008 Feb 29.Inhibition of carbonic anhydrases with glycosyltriazole benzene sulfonamides.
Ref 529381J Med Chem. 2008 Jun 12;51(11):3051-6. Epub 2008 Mar 19.Recent developments of carbonic anhydrase inhibitors as potential anticancer drugs.
Ref 529562Bioorg Med Chem. 2008 Aug 1;16(15):7424-8. Epub 2008 Jun 13.Carbonic anhydrase inhibitors: inhibition of mammalian isoforms I-XIV with a series of substituted phenols including paracetamol and salicylic acid.
Ref 529605Bioorg Med Chem Lett. 2008 Aug 1;18(15):4282-6. Epub 2008 Jul 5.Carbonic anhydrase inhibitors. Interaction of the antitumor sulfamate EMD 486019 with twelve mammalian carbonic anhydrase isoforms: Kinetic and X-ray crystallographic studies.
Ref 529609Bioorg Med Chem Lett. 2008 Aug 15;18(16):4624-7. Epub 2008 Jul 10.Inhibition of human mitochondrial carbonic anhydrases VA and VB with para-(4-phenyltriazole-1-yl)-benzenesulfonamide derivatives.
Ref 529721Bioorg Med Chem. 2008 Oct 15;16(20):9101-5. Epub 2008 Sep 13.In vitro inhibition of salicylic acid derivatives on human cytosolic carbonic anhydrase isozymes I and II.
Ref 529794Bioorg Med Chem Lett. 2008 Dec 15;18(24):6332-5. Epub 2008 Nov 1.Carbonic anhydrase inhibitors: 2-substituted-1,3,4-thiadiazole-5-sulfamides act as powerful and selective inhibitors of the mitochondrial isozymes VA and VB over the cytosolic and membrane-associated carbonic anhydrases I, II and IV.
Ref 529884Bioorg Med Chem. 2009 Jan 15;17(2):553-7. Epub 2008 Dec 6.Ligand-based and structure-based virtual screening to identify carbonic anhydrase IX inhibitors.
Ref 529948J Med Chem. 2009 Feb 12;52(3):646-54.Cloning, expression, post-translational modifications and inhibition studies on the latest mammalian carbonic anhydrase isoform, CA XV.
Ref 530003Bioorg Med Chem Lett. 2009 Apr 1;19(7):1855-7. Epub 2009 Feb 26.Carbonic anhydrase inhibitors. Inhibition of cytosolic isoforms I, II, III, VII and XIII with less investigated inorganic anions.
Ref 530046Nat Chem Biol. 2009 May;5(5):341-3. Epub 2009 Mar 29.Ligand-directed tosyl chemistry for protein labeling in vivo.
Ref 530086Bioorg Med Chem Lett. 2009 May 15;19(10):2642-5. Epub 2009 Apr 5.Carbonic anhydrase inhibitors. Inhibition of the fungal beta-carbonic anhydrases from Candida albicans and Cryptococcus neoformans with boronic acids.
Ref 530132J Med Chem. 2009 Jul 9;52(13):4063-7.Discovery of low nanomolar and subnanomolar inhibitors of the mycobacterial beta-carbonic anhydrases Rv1284 and Rv3273.
Ref 530219Bioorg Med Chem. 2009 Jul 15;17(14):4894-9. Epub 2009 Jun 9.Carbonic anhydrase inhibitors. Aromatic/heterocyclic sulfonamides incorporating phenacetyl, pyridylacetyl and thienylacetyl tails act as potent inhibitors of human mitochondrial isoforms VA and VB.
Ref 530359J Med Chem. 2009 Oct 8;52(19):5990-8.Carbonic anhydrase inhibitors. Comparison of aliphatic sulfamate/bis-sulfamate adducts with isozymes II and IX as a platform for designing tight-binding, more isoform-selective inhibitors.
Ref 530514J Med Chem. 2010 Jan 14;53(1):335-44.Deciphering the mechanism of carbonic anhydrase inhibition with coumarins and thiocoumarins.
Ref 530578Bioorg Med Chem. 2010 Jan 15;18(2):930-8. Epub 2009 Nov 20.Synthesis, characterization and antiglaucoma activity of a novel proton transfer compound and a mixed-ligand Zn(II) complex.
Ref 530751Bioorg Med Chem. 2010 Mar 15;18(6):2159-64. Epub 2010 Feb 6.Carbonic anhydrase inhibitors. Inhibition of mammalian isoforms I-XIV with a series of natural product polyphenols and phenolic acids.
Ref 530766Eur J Med Chem. 2010 Jun;45(6):2396-404. Epub 2010 Feb 12.Carbonic anhydrase inhibitors: synthesis and inhibition of the human cytosolic isozymes I and II and transmembrane isozymes IX, XII (cancer-associated) and XIV with 4-substituted 3-pyridinesulfonamides.
Ref 530922Bioorg Med Chem Lett. 2010 Jun 15;20(12):3601-5. Epub 2010 Apr 28.Carbonic anhydrase inhibitors: crystallographic and solution binding studies for the interaction of a boron-containing aromatic sulfamide with mammalian isoforms I-XV.
Ref 530978Eur J Med Chem. 2010 Sep;45(9):3656-61. Epub 2010 May 12.Carbonic anhydrase inhibitors. Regioselective synthesis of novel 1-substituted 1,4-dihydro-4-oxo-3-pyridinesulfonamides and their inhibition of the human cytosolic isozymes I and II and transmembrane cancer-associated isozymes IX and XII.
Ref 530979Bioorg Med Chem. 2010 Jun 15;18(12):4468-74. Epub 2010 May 28.A novel and one-pot synthesis of new 1-tosyl pyrrol-2-one derivatives and analysis of carbonic anhydrase inhibitory potencies.
Ref 530998J Med Chem. 2010 Aug 12;53(15):5511-22.Polyamines inhibit carbonic anhydrases by anchoring to the zinc-coordinated water molecule.
Ref 531031Bioorg Med Chem. 2010 Aug 1;18(15):5498-503. Epub 2010 Jun 22.Mutation of Phe91 to Asn in human carbonic anhydrase I unexpectedly enhanced both catalytic activity and affinity for sulfonamide inhibitors.
Ref 531068Bioorg Med Chem Lett. 2010 Sep 1;20(17):5050-3. Epub 2010 Jul 13.Carbonic anhydrase inhibitors. Antioxidant polyphenols effectively inhibit mammalian isoforms I-XV.
Ref 531112Eur J Med Chem. 2010 Nov;45(11):4769-73. Epub 2010 Jul 24.Synthesis, characterization and antiglaucoma activity of some novel pyrazole derivatives of 5-amino-1,3,4-thiadiazole-2-sulfonamide.
Ref 531156Bioorg Med Chem Lett. 2010 Nov 1;20(21):6208-12. Epub 2010 Aug 26.Paraoxon, 4-nitrophenyl phosphate and acetate are substrates of |A- but not of |A-, |?- and |?-carbonic anhydrases.
Ref 531259Bioorg Med Chem Lett. 2010 Dec 15;20(24):7255-8. Epub 2010 Oct 25.7,8-disubstituted- but not 6,7-disubstituted coumarins selectively inhibit the transmembrane, tumor-associated carbonic anhydrase isoforms IX and XII over the cytosolic ones I and II in the low nanomolar/subnanomolar range.
Ref 531635Therapeutic target database update 2012: a resource for facilitating target-oriented drug discovery. Nucleic Acids Res. 2012 Jan;40(Database issue):D1128-36.
Ref 533275Understanding the Dual Inhibition of COX-2 and Carbonic Anhydrase-II by Celecoxib and CG100649 Using Density Functional Theory Calculations and other Molecular Modelling Approaches. Protein Pept Lett. 2015;22(10):903-12.
Ref 533846Dose-dependent pharmacokinetics of L-693,612, a carbonic anhydrase inhibitor, following oral administration in rats. Pharm Res. 1994 Mar;11(3):438-41.
Ref 535861Inhibition of carbonic anhydrases I and II by N-unsubstituted carbamate esters. J Biol Chem. 1992 Dec 15;267(35):25044-50.
Ref 537461Carbonic anhydrase inhibitors. Inhibition studies of a coral secretory isoform by sulfonamides. Bioorg Med Chem. 2009 Jul 15;17(14):5054-8. Epub 2009 May 30.
Ref 538055Sulfenamido-sulfonamides as inhibitors of carbonic anhydrase isozymes I, II and IV. J Enzyme Inhib. 1997 Aug;12(3):175-90.
Ref 538135Carbonic anhydrase inhibitors: inhibition of isozymes I, II and IV with N-hydroxysulfonamides--a novel class of intraocular pressure lowering agents. J Enzyme Inhib. 1998 Jul;13(4):267-84.
Ref 543654(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2597).
Ref 551223Pteridine-sulfonamide conjugates as dual inhibitors of carbonic anhydrases and dihydrofolate reductase with potential antitumor activity. Bioorg Med Chem. 2010 Jul 15;18(14):5081-9. doi: 10.1016/j.bmc.2010.05.072. Epub 2010 Jun 2.
Ref 551374The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
Ref 556264Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
Ref 1587926URL: https://www.ebi.ac.uk/chembl/ The ChEMBL database in 2017

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.