Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T40800
|
||||
Former ID |
TTDS00045
|
||||
Target Name |
Sodium/potassium-transporting ATPase alpha-1 chain
|
||||
Gene Name |
ATP1A1
|
||||
Synonyms |
Na+/K+ ATPase 1; Sodium pump 1; Sodium/potassium-transporting ATPase alpha1; ATP1A1
|
||||
Target Type |
Successful
|
||||
Disease | Atrial fibrillation; Heart failure [ICD9: 427.31, 428.0; ICD10: I48, I50] | ||||
Anesthesia [ICD9: 338; ICD10: R20.0] | |||||
Congestive heart failure [ICD9: 428; ICD10: I50] | |||||
Congestive cardiac insufficiency; Arrhythmias; Heart failure [ICD9: 427, 428; ICD10: I47-I49, I50] | |||||
Chronic obstructive pulmonary disease [ICD9: 490-492, 494-496; ICD10: J40-J44, J47] | |||||
Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
Hyperhidrosis [ICD9: 780.8; ICD10: R61] | |||||
Malaria [ICD10: B54] | |||||
Function |
This is the catalytic component of the active enzyme, which catalyzes the hydrolysis of atp coupled with the exchange of sodium and potassium ions across the plasma membrane. This action creates the electrochemical gradient of sodium and potassium ions.
|
||||
BioChemical Class |
Acid anhydrides hydrolase
|
||||
Target Validation |
T40800
|
||||
UniProt ID | |||||
EC Number |
EC 3.6.3.9
|
||||
Sequence |
MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLS
RGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGGFSMLLWIGAILCFLAYSIQAA TEEEPQNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSI NAEEVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETR NIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQTPIAAEIEHFIHIITGVAV FLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKN LEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWLA LSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLKCIELCCGSVKEMRERYAKIVEI PFNSTNKYQLSIHKNPNTSEPQHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQN AYLELGGLGERVLGFCHLFLPDEQFPEGFQFDTDDVNFPIDNLCFVGLISMIDPPRAAVP DAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDA KACVVHGSDLKDMTSEQLDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVN DSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTL TSNIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPK TDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPIHLLGLRVDWDDRWINDVED SYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFE ETALAAFLSYCPGMGVALRMYPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKE TYY |
||||
Drugs and Mode of Action | |||||
Drug(s) | Acetyldigitoxin | Drug Info | Approved | Congestive heart failure | [538419], [541875] |
Almitrine | Drug Info | Approved | Chronic obstructive pulmonary disease | [534891] | |
Aluminium | Drug Info | Approved | Hyperhidrosis | [550682] | |
Artemether | Drug Info | Approved | Malaria | [536602] | |
Chloroprocaine | Drug Info | Approved | Anesthesia | [538175], [542152] | |
Deslanoside | Drug Info | Approved | Congestive cardiac insufficiency; Arrhythmias; Heart failure | [538415], [541888], [551871] | |
Lumefantrine | Drug Info | Approved | Malaria | [551871] | |
Ouabain | Drug Info | Approved | Atrial fibrillation; Heart failure | [468058], [550772] | |
Artemether | Drug Info | Phase 3 | Malaria | [531808], [551871] | |
UNBS-1450 | Drug Info | Phase 1 | Cancer | [548863] | |
Modulator | Acetyldigitoxin | Drug Info | [556264] | ||
Binder | Almitrine | Drug Info | [537663], [537686] | ||
Aluminium | Drug Info | [535839], [536035] | |||
Artemether | Drug Info | [536602] | |||
Deslanoside | Drug Info | [536316] | |||
Lumefantrine | Drug Info | [536602] | |||
Ouabain | Drug Info | [536316] | |||
Blocker | Chloroprocaine | Drug Info | [535175] | ||
Inhibitor | DIGITOXIGENIN | Drug Info | [525814] | ||
UNBS-1450 | Drug Info | [533266] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | cGMP-PKG signaling pathway | ||||
cAMP signaling pathway | |||||
Cardiac muscle contraction | |||||
Adrenergic signaling in cardiomyocytes | |||||
Insulin secretion | |||||
Thyroid hormone synthesis | |||||
Thyroid hormone signaling pathway | |||||
Aldosterone-regulated sodium reabsorption | |||||
Endocrine and other factor-regulated calcium reabsorption | |||||
Proximal tubule bicarbonate reclamation | |||||
Salivary secretion | |||||
Gastric acid secretion | |||||
Pancreatic secretion | |||||
Carbohydrate digestion and absorption | |||||
Protein digestion and absorption | |||||
Bile secretion | |||||
Mineral absorption | |||||
PathWhiz Pathway | Kidney Function | ||||
Lactose Degradation | |||||
Trehalose Degradation | |||||
Muscle/Heart Contraction | |||||
Reactome | Ion transport by P-type ATPases | ||||
WikiPathways | Iron uptake and transport | ||||
References | |||||
Ref 468058 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4826). | ||||
Ref 531808 | Lack of association of the S769N mutation in Plasmodium falciparum SERCA (PfATP6) with resistance to artemisinins. Antimicrob Agents Chemother. 2012 May;56(5):2546-52. | ||||
Ref 534891 | Improving oxygenation during bronchopulmonary lavage using nitric oxide inhalation and almitrine infusion. Anesth Analg. 1999 Aug;89(2):302-4. | ||||
Ref 536602 | The fight against drug-resistant malaria: novel plasmodial targets and antimalarial drugs. Curr Med Chem. 2008;15(2):161-71. | ||||
Ref 538175 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 040273. | ||||
Ref 538415 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 009282. | ||||
Ref 538419 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 009436. | ||||
Ref 541875 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6794). | ||||
Ref 541888 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6806). | ||||
Ref 542152 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7145). | ||||
Ref 525814 | J Med Chem. 2000 Jun 15;43(12):2332-49.17beta-O-Aminoalkyloximes of 5beta-androstane-3beta,14beta-diol with digitalis-like activity: synthesis, cardiotonic activity, structure-activity relationships,and molecular modeling of the Na(+),K(+)-ATPase receptor. | ||||
Ref 533266 | Early downregulation of Mcl-1 regulates apoptosis triggered by cardiac glycoside UNBS1450. Cell Death Dis. 2015 Jun 11;6:e1782. | ||||
Ref 535175 | Inhibition of the Na,K-ATPase of canine renal medulla by several local anesthetics. Pharmacol Res. 2001 Apr;43(4):399-403. | ||||
Ref 535839 | The inhibitory effect of aluminium on the (Na+/K+)ATPase activity of rat brain cortex synaptosomes. J Inorg Biochem. 2003 Sep 15;97(1):143-50. | ||||
Ref 536035 | Effects of aluminium and lead on ATPase activity of knockout +/- mouse cerebral synaptosomes in vitro. Altern Lab Anim. 2004 Oct;32(4):361-7. | ||||
Ref 536602 | The fight against drug-resistant malaria: novel plasmodial targets and antimalarial drugs. Curr Med Chem. 2008;15(2):161-71. | ||||
Ref 537663 | Flux-dependent increase in the stoichiometry of charge translocation by mitochondrial ATPase/ATP synthase induced by almitrine. Biochim Biophys Acta. 1990 Jul 17;1018(1):91-7. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.