Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T45593
|
||||
Former ID |
TTDI01945
|
||||
Target Name |
Microtubule-associated protein tau
|
||||
Gene Name |
MAPT
|
||||
Synonyms |
Neurofibrillary tangle protein; PHFtau; Paired helical filamenttau; MAPT
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Alzheimer disease [ICD9: 331; ICD10: G30] | ||||
Cognitive disorders [ICD9: 290-294, 294.0, 780.09, 780.9, 780.93; ICD10: F01-F07, F04, F05, R41.3] | |||||
Central nervous system disease [ICD10: G00-G99] | |||||
Neurodegenerative disease [ICD9: 330-337; ICD10: G30-G32] | |||||
Function |
Promotes microtubule assembly and stability, and might be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N- terminus binds neural plasma membrane components, suggesting that tau functions as a linker protein between both. Axonal polarity is predetermined by TAU/MAPT localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. The short isoforms allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization. {ECO:0000269|PubMed:21985311}.
|
||||
UniProt ID | |||||
Sequence |
MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPG
SETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAG HVTQEPESGKVVQEGFLREPGPPGLSHQLMSGMPGAPLLPEGPREATRQPSGTGPEDTEG GRHAPELLKHQLLGDLHQEGPPLKGAGGKERPGSKEEVDEDRDVDESSPQDSPPSKASPA QDGRPPQTAAREATSIPGFPAEGAIPLPVDFLSKVSTEIPASEPDGPSVGRAKGQDAPLE FTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPA AAPRGKPVSRVPQLKARMVSKSKDGTGSDDKKAKTSTRSSAKTLKNRPCLSPKHPTPGSS DPLIQPSSPAVCPEPPSSPKYVSSVTSRTGSSGAKEMKLKGADGKTKIATPRGAAPPGQK GQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREP KKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLD LSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEK LDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDT SPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL |
||||
Drugs and Mode of Action | |||||
Drug(s) | Davunetide intranasal spray | Drug Info | Phase 3 | Cognitive disorders | [531616] |
LMT-X | Drug Info | Phase 3 | Alzheimer disease | [549271] | |
PBT-2 | Drug Info | Phase 2 | Alzheimer disease | [523892] | |
Tau-binding PET tracer | Drug Info | Phase 2 | Alzheimer disease | [525148] | |
PTI-80 | Drug Info | Phase 1 | Alzheimer disease | [548777] | |
Modulator | AL-408 | Drug Info | [531616] | ||
BLV-0703 | Drug Info | [531616] | |||
Davunetide intranasal spray | Drug Info | [531616] | |||
NI-105 | Drug Info | [531616] | |||
PBT-2 | Drug Info | [530731], [531616] | |||
ReS8-T compounds | Drug Info | [531616] | |||
Tau-binding PET tracer | Drug Info | [531616] | |||
Inhibitor | LMT-X | Drug Info | [531616], [550088] | ||
PTI-80 | Drug Info | [531616], [551508] | |||
Tau phosphorylation inhibitors | Drug Info | [531616] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | MAPK signaling pathway | ||||
Alzheimer' | |||||
s disease | |||||
NetPath Pathway | IL2 Signaling Pathway | ||||
EGFR1 Signaling Pathway | |||||
Pathway Interaction Database | LPA receptor mediated events | ||||
Reelin signaling pathway | |||||
Reactome | Caspase-mediated cleavage of cytoskeletal proteins | ||||
WikiPathways | Notch Signaling Pathway | ||||
IL-2 Signaling Pathway | |||||
MAPK Signaling Pathway | |||||
Copper homeostasis | |||||
Kit receptor signaling pathway | |||||
BDNF signaling pathway | |||||
Integrated Pancreatic Cancer Pathway | |||||
Alzheimers Disease | |||||
Regulation of Microtubule Cytoskeleton | |||||
Apoptotic execution phase | |||||
IL-5 Signaling Pathway | |||||
References | |||||
Ref 523892 | ClinicalTrials.gov (NCT01590888) Effect of PBT2 in Patients With Early to Mid Stage Huntington Disease. U.S. National Institutes of Health. | ||||
Ref 525148 | ClinicalTrials.gov (NCT02414347) F 18 T807 Tau PET Imaging of Alzheimer's Disease. U.S. National Institutes of Health. | ||||
Ref 531616 | Microtubules (tau) as an emerging therapeutic target: NAP (davunetide). Curr Pharm Des. 2011;17(31):3413-7. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.