Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T56697
|
||||
Former ID |
TTDNC00370
|
||||
Target Name |
DKK1 protein
|
||||
Gene Name |
DKK1
|
||||
Synonyms |
Dickkopf1; Dickkopfrelated protein 1; Dkk1; SK; hDkk1; DKK1
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Multiple myeloma [ICD9: 203; ICD10: C90] | ||||
Osteoporosis [ICD9: 733.0, V07.4; ICD10: M80-M81, Z79.890] | |||||
Function |
Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero- posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease.
|
||||
BioChemical Class |
Dickkopf family
|
||||
UniProt ID | |||||
Sequence |
MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAV
SAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKR CMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYH TKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCG EGLSCRIQKDHHQASNSSRLHTCQRH |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Wnt signaling pathway | ||||
NetPath Pathway | TGF_beta_Receptor Signaling Pathway | ||||
Wnt Signaling Pathway | |||||
FSH Signaling Pathway | |||||
Pathway Interaction Database | Presenilin action in Notch and Wnt signaling | ||||
Wnt signaling network | |||||
Direct p53 effectors | |||||
Regulation of nuclear beta catenin signaling and target gene transcription | |||||
Validated targets of C-MYC transcriptional repression | |||||
Reactome | TCF dependent signaling in response to WNT | ||||
Negative regulation of TCF-dependent signaling by WNT ligand antagonists | |||||
WikiPathways | Mesodermal Commitment Pathway | ||||
Endoderm Differentiation | |||||
Differentiation Pathway | |||||
Cytodifferentiation (Part 3 of 3) | |||||
Primary Focal Segmental Glomerulosclerosis FSGS | |||||
Cardiac Progenitor Differentiation | |||||
References |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.