Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T00820
|
||||
Former ID |
TTDR01270
|
||||
Target Name |
ATP-sensitive inward rectifier potassium channel 11
|
||||
Gene Name |
KCNJ11
|
||||
Synonyms |
IKATP; Inward rectifier K+ channel Kir6.2; KATP channel (Kir6.2/SUR2A); Potassium channel, inwardly rectifying, subfamily J, member 11; KCNJ11
|
||||
Target Type |
Research
|
||||
Function |
This receptor is controlled by G proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium (By similarity). Subunit of ATP-sensitive potassium channels (KATP). Can form cardiac and smooth muscle-type KATP channels with ABCC9. KCNJ11 forms the channel pore while ABCC9 is required for activation and regulation.
|
||||
BioChemical Class |
Inward rectifier K(+) channel
|
||||
Target Validation |
T00820
|
||||
UniProt ID | |||||
Sequence |
MLSRKGIIPEEYVLTRLAEDPAEPRYRARQRRARFVSKKGNCNVAHKNIREQGRFLQDVF
TTLVDLKWPHTLLIFTMSFLCSWLLFAMAWWLIAFAHGDLAPSEGTAEPCVTSIHSFSSA FLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAET LIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM ENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQA RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTIKVPTPLCTARQLDEDHSLLEALT LASARGPLRKRSVPMAKAKPKFSISPDSLS |
||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
DRM | DRM Info | ||||
Pathways | |||||
KEGG Pathway | Insulin secretion | ||||
Type II diabetes mellitus | |||||
Pathway Interaction Database | FOXA2 and FOXA3 transcription factor networks | ||||
PathWhiz Pathway | Muscle/Heart Contraction | ||||
Reactome | ABC-family proteins mediated transport | ||||
Regulation of insulin secretion | |||||
WikiPathways | Potassium Channels | ||||
Integration of energy metabolism | |||||
Type II diabetes mellitus | |||||
References |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.