Target Information

Target General Infomation
Target ID
T30082
Former ID
TTDS00140
Target Name
Acetylcholinesterase
Gene Name
ACHE
Synonyms
AChE; ACHE
Target Type
Successful
Disease Alzheimer disease [ICD9: 331; ICD10: G30]
Alzheimer disease; Mild cognitive impairment [ICD9: 331.0, 331.83; ICD10: F06.7, G30, G31.84]
Alcohol use disorders [ICD9: 303; ICD10: F10.2]
Cognitive disorders [ICD9: 290-294, 294.0, 780.09, 780.9, 780.93; ICD10: F01-F07, F04, F05, R41.3]
Cancer [ICD9: 140-229; ICD10: C00-C96]
Chronic glaucoma [ICD9: 365; ICD10: H40-H42]
Epileptic seizures; Alzheimer disease [ICD9:345.9, 780.3, 331; ICD10: G40, P90, R56, G30]
Glaucoma [ICD9: 365; ICD10: H40-H42]
Helminth infection [ICD9: 001-139; ICD10: A00-B99]
Myasthenia gravis [ICD9: 358; ICD10: G70.0]
Myasthenia gravis diagnosis [ICD9: 358; ICD10: G70.0]
Neurodegenerative disease [ICD9: 330-337; ICD10: G30-G32]
Open-angle glaucoma; Anxiety disorder [ICD9:365, 300, 311; ICD10: H40-H42, F32, F40-F42]
Poisoning due to pesticides and chemicals [ICD10: T36-T50]
Poison intoxication [ICD10: T36-T50]
Parkinson's disease [ICD9: 332; ICD10: G20]
Pediculus humanus capitis [ICD9: 132; ICD10: B85.0]
Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89]
Urinary dysfunction [ICD10: N39.3-N39.4]
Upper abdominal bloating; Early satiation associated with functional dyspepsia [ICD9: 536.8; ICD10: K30]
Xerostomia [ICD9: 527.7; ICD10: K11.7, R68.2]
Unspecified [ICD code not available]
Function
Rapidly hydrolyzes choline released into the synapse.
BioChemical Class
Carboxylic ester hydrolase
Target Validation
T30082
UniProt ID
P22303
EC Number
EC 3.1.1.7
Sequence
MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPV
SAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPN
RELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSM
NYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASV
GMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTEL
VACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVG
VVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPE
DPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGY
EIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQ
YVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN
QFDHYSKQDRCSDL
Drugs and Mode of Action
Drug(s) Ambenonium Drug Info Approved Myasthenia gravis [538427]
Demecarium bromide Drug Info Approved Open-angle glaucoma; Anxiety disorder [538451], [551871]
Donepezil Drug Info Approved Alzheimer disease [541717], [544878], [551871]
Echothiophate Iodide Drug Info Approved Chronic glaucoma [538454]
Edrophonium Drug Info Approved Myasthenia gravis diagnosis [538168]
Galantamine Drug Info Approved Alzheimer disease [536285], [541798]
Huperzine A Drug Info Approved Epileptic seizures; Alzheimer disease [544707], [551871]
Isoflurophate Drug Info Approved Glaucoma [536300]
Malathion Drug Info Approved Pediculus humanus capitis [538333]
Neostigmine Drug Info Approved Myasthenia gravis [550269]
Pralidoxime Chloride Drug Info Approved Poisoning due to pesticides and chemicals [551871]
Pyridostigmine Drug Info Approved Myasthenia gravis [538182]
Rivastigmine Drug Info Approved Alzheimer disease [522744], [541722]
Tacrine Drug Info Approved Alzheimer disease [536361], [541792]
YM443 Drug Info Approved Upper abdominal bloating; Early satiation associated with functional dyspepsia [551871]
(-)-Phenserine Drug Info Phase 3 Alzheimer disease [532220]
Amocarzine Drug Info Phase 3 Helminth infection [534433]
Eptastigmine Drug Info Phase 3 Cognitive disorders [526265]
INM-176 Drug Info Phase 3 Alzheimer disease [523260]
Suronacrine maleate Drug Info Phase 3 Cognitive disorders [551848]
Ladostigil Drug Info Phase 2 Alzheimer disease [531772]
Methanesulfonyl fluoride Drug Info Phase 2 Alzheimer disease [549186]
R-phenserine Drug Info Phase 2 Alzheimer disease; Mild cognitive impairment [548049]
T-82 Drug Info Phase 2 Cognitive disorders [526578]
Desoxypeganine Drug Info Phase 1 Alcohol use disorders [529540]
KW-5092 Drug Info Phase 1 Pain [534378]
PRX-105 Drug Info Phase 1 Poison intoxication [522989]
ZT-1 Drug Info Phase 1 Parkinson's disease [532328]
PHENSERINE TARTRATE Drug Info Preclinical Parkinson's disease [547033]
SPH-1285 Drug Info Preclinical Alzheimer disease [547351]
VELNACRINE Drug Info Discontinued in Phase 3 Cognitive disorders [527051]
Zanapezil Drug Info Discontinued in Phase 3 Alzheimer disease [545741]
Caracemide Drug Info Discontinued in Phase 2 Cancer [544726]
HP-290 Drug Info Discontinued in Phase 2 Parkinson's disease [546136]
Icopezil maleate Drug Info Discontinued in Phase 2 Cognitive disorders [546140]
Physostigmine Drug Info Discontinued in Phase 2 Xerostomia [541716], [548786]
S-9977 Drug Info Discontinued in Phase 2 Cognitive disorders [544962]
SM-10888 Drug Info Discontinued in Phase 2 Cognitive disorders [544850]
TAK-802 Drug Info Discontinued in Phase 2 Urinary dysfunction [547886]
ZIFROSILONE Drug Info Discontinued in Phase 2 Cognitive disorders [545006]
NP-61 Drug Info Discontinued in Phase 1 Alzheimer disease [548783]
7-methoxytacrine Drug Info Terminated Discovery agent [545830]
ABS-301 Drug Info Terminated Alzheimer disease [546251]
CI-1002 Drug Info Terminated Alzheimer disease [533784]
F-3796 Drug Info Terminated Alzheimer disease [545742]
FR-152558 Drug Info Terminated Alzheimer disease [546174]
MF-8615 Drug Info Terminated Alzheimer disease [546215]
MF268 Drug Info Terminated Alzheimer disease [546262]
NP-7557 Drug Info Terminated Alzheimer disease [547586]
Ro-46-5934 Drug Info Terminated Alzheimer disease [533753]
Inhibitor (+/-)-huprineY hydrochloride Drug Info [528570]
(-)-huperzine B Drug Info [529473]
(-)-Phenserine Drug Info [551218]
(-)-Tolserine Drug Info [551218]
(1R)-1,2,2-TRIMETHYLPROPYL (S)-METHYLPHOSPHINATE Drug Info [551374]
(2-Butyryloxy-ethyl)-trimethyl-ammonium iodide Drug Info [534296]
(2-Chloro-ethyl)-trimethyl-ammonium chloride Drug Info [534296]
(2-Ethoxy-ethyl)-trimethyl-ammonium iodide Drug Info [534296]
(2-Mercapto-ethyl)-trimethyl-ammonium iodide Drug Info [534296]
(24S)-ethylcholesta-7,9(11),22(E)-triene-3b-ol Drug Info [527846]
(3-Bromo-propyl)-trimethyl-ammonium Drug Info [534296]
(3-Hydroxy-2-methyl-phenyl)-trimethyl-ammonium Drug Info [534296]
(3R)-9-amino-3-methyl-1,2,3,4-tetrahydroacridine Drug Info [530551]
(4-Bromo-butyl)-trimethyl-ammonium Drug Info [534296]
(4-Iodo-butyl)-trimethyl-ammonium iodide Drug Info [534296]
(5-Bromo-pentyl)-trimethyl-ammonium Drug Info [534296]
(R)-tacrine(10)-hupyridone Drug Info [551374]
(RS)-tacrine(10)-hupyridone Drug Info [529473]
(S)-tacrine(10)-hupyridone Drug Info [551374]
(S,S)-(-)-bis(10)-hupyridone Drug Info [529473]
(S,S)-(-)-bis(12)-hupyridone Drug Info [529473]
1,10-bis(pyridinium)-decane dibromide Drug Info [530696]
1,11-bis(pyridinium)-undecane dibromide Drug Info [530696]
1,2-Di(berberine-9-O-yl)ethane dibromide Drug Info [530920]
1,2-NAPHTHOQUINONE Drug Info [529103]
1,3-Bis-(3-imidazolidin-2-yl-phenyl)-urea Drug Info [527214]
1,3-Di(berberine-9-O-yl)ethane dibromide Drug Info [530920]
1,4-Di(berberine-9-O-yl)ethane dibromide Drug Info [530920]
1,9-bis(pyridinium)-nonane dibromide Drug Info [530696]
1-(3-Bromomethyl-phenyl)-2,2,2-trifluoro-ethanone Drug Info [526149]
1-benzene sulfonyl-cis-2,6-dimethyl piperidine Drug Info [530187]
1-Deoxy-1-Thio-Heptaethylene Glycol Drug Info [551374]
1-ETHOXY-2-(2-ETHOXYETHOXY)ETHANE Drug Info [551374]
10-Hydroxy-infractopicrin Drug Info [530743]
2,3-dihydropyrrolo[2,1-b]quinazolin-9(1H)-imine Drug Info [528402]
2-(Acetylamino)-2-Deoxy-a-D-Glucopyranose Drug Info [551393]
2-(N-Morpholino)-Ethanesulfonic Acid Drug Info [551393]
2-Hex-5-enyl-5-non-8-enyl-3,4-dihydro-2H-pyrrole Drug Info [551277]
2-Hex-5-enyl-5-non-8-enyl-pyrrolidine Drug Info [551277]
2-Hex-5-enyl-5-nonyl-pyrrolidine Drug Info [551277]
2-morpholino-N-phenethylpyrimidin-4-amine Drug Info [530923]
2-Propyl-beta-carboline-2-ium iodide Drug Info [530824]
24-ethyl-cholest-7-ene-3,5,6-triol Drug Info [527846]
24-ethylcholest-6-ene-3,5-diol Drug Info [527846]
3,4,5,6-Tetrachloro-[1,2]benzoquinone Drug Info [527510]
3,6,9,12,15-Pentaoxaheptadecane Drug Info [551374]
3,7-BIS(DIMETHYLAMINO)PHENOTHIAZIN-5-IUM Drug Info [551374]
3-(2,5-Dioxo-pyrrolidin-1-yl)-benzoic acid Drug Info [526619]
3-(2-Diethylamino-acetamino)-rutaecarpine Drug Info [530639]
3-(2-Diethylamino-propionamino)-rutaecarpine Drug Info [530639]
3-(2-N-Piperidyl-acetamino)-rutaecarpine Drug Info [530639]
3-(2-N-Piperidyl-propionamino)-rutaecarpine Drug Info [530639]
3-(2-N-Pyrrolyl-acetamino)-rutaecarpine Drug Info [530639]
3-(2-N-Pyrrolyl-propionamino)-rutaecarpine Drug Info [530639]
3-(3-Carboxy-propionylamino)-benzoic acid Drug Info [526619]
3-(4-Benzoylpiperazine-1-carbonyl)coumarin Drug Info [529641]
3-(4-o-Tolylpiperazine-1-carbonyl)coumarin Drug Info [529641]
3-(4-Phenylpiperazin-1-carbonyl)coumarin Drug Info [529641]
3-(dimethylamino)phenyl phenylcarbamate Drug Info [551218]
3-hydroxy-N,N,N-trimethylbenzenaminium iodide Drug Info [529567]
3-[(1s)-1-(Dimethylamino)Ethyl]Phenol Drug Info [551374]
3-[2-(1-Benzyl-piperidin-4-yl)-ethyl]-1H-indazole Drug Info [527249]
3-[3-(benzylmethylamino)propoxy]xanthen-9-one Drug Info [528456]
3-[4-(benzylmethylamino)butoxy]xanthen-9-one Drug Info [528456]
3-[5-(benzylmethylamino)pentyloxy]xanthen-9-one Drug Info [528456]
3-[6-(benzylmethylamino)hexyloxy]xanthen-9-one Drug Info [528456]
3-[7-(benzylmethylamino)-heptyloxy]xanthen-9-one Drug Info [528456]
3-[8-(benzylmethylamino)octyloxy]xanthen-9-one Drug Info [528456]
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one Drug Info [531079]
4-formylphenyl-O-beta-D-ribopyranoside Drug Info [528897]
4-formylphenyl-O-beta-Dglucopyranoside Drug Info [528897]
4-ISOPROPYLPHENSERINE Drug Info [530692]
4-[4-(benzhydryloxy)piperidino]butyl benzoate Drug Info [528979]
4ALPHA-(HYDROXYMETHYL)-4ALPHA-DEMETHYLTERRITREM B Drug Info [534457]
5,6-dinitroacenaphthoquinone Drug Info [529103]
5-Chloro-1,2,3,4-tetrahydro-acridin-9-ylamine Drug Info [551237]
5-Hex-5-enyl-2-nonyl-3,4-dihydro-2H-pyrrole Drug Info [551277]
6,8-Dichloro-1,2,3,4-tetrahydro-acridin-9-ylamine Drug Info [526093]
6-chlorotacrine hydrochloride Drug Info [530301]
6-hydroxy-1,2,9-trimethyl-9H-beta-carbolin-2-ium Drug Info [528415]
6-hydroxy-1,2-dimethyl-9H-beta-carbolin-2-ium Drug Info [528415]
6-hydroxy-2,9-dimethyl-9H-beta-carbolin-2-ium Drug Info [528415]
6-hydroxy-2-methyl-9H-beta-carbolin-2-ium Drug Info [528415]
6-methoxy-1,2-dimethyl-9H-beta-carbolin-2-ium Drug Info [528415]
6-methoxy-1,9-dimethyl-9H-pyrido[3,4-b]indole Drug Info [528415]
6-methoxy-2,9-dimethyl-9H-beta-carbolin-2-ium Drug Info [528415]
6-methoxy-2-methyl-9H-beta-carbolin-2-ium Drug Info [528415]
6-Methyl-4-(4-benzoylpiperazin-1-yl)coumarin Drug Info [529641]
6-Methyl-4-(4-o-tolylpiperazin-1-yl)coumarin Drug Info [529641]
6-Methyl-4-(4-phenylpiperazin-1-yl)coumarin Drug Info [529641]
7-Chloro-1,2,3,4-tetrahydro-acridin-9-ylamine Drug Info [551237]
7-methoxytacrine Drug Info [531150]
7-Oxo-7H-dibenzo[de,g]quinoline Drug Info [529985]
8-Chloro-1,2,3,4-tetrahydro-acridin-9-ylamine Drug Info [551237]
9-Amino-1,2,3,4-tetrahydro-acridine-1,7-diol Drug Info [551238]
9-amino-7H-dibenzo[de,h]quinolin-7-one Drug Info [529985]
9-Ethyl-2-methyl-beta-carboline-2-ium iodide Drug Info [530824]
9-Ethyl-beta-carboline Drug Info [530824]
9-hydrazino-1,2,3,4-tetrahydroacridine Drug Info [528564]
9-O-[2-(Phenylol-1-yloxy)ethyl]berberine bromide Drug Info [530625]
9-O-[2-(Phenylol-1-yloxy)hexyl]berberine bromide Drug Info [530625]
9-O-[3-(2-Pyridinoxyl)butyl]-berberine bromide Drug Info [530920]
9-O-[3-(4-Bromo-phenoxyl)butyl]-berberine bromide Drug Info [530920]
9-O-[3-(4-Nitro-phenoxyl)butyl]-berberine bromide Drug Info [530920]
9-O-[3-(Phenylamino)propyl]-berberine bromide Drug Info [530920]
9-O-[3-(Phenylol-1-yloxy)propyl]berberine bromide Drug Info [530625]
9-O-[4-(Phenylol-1-yloxy)butyl]berberine bromide Drug Info [530625]
9-O-[5-(Phenylol-1-yloxy)pentyl]berberine bromide Drug Info [530625]
Alkylene Linked Bis-Galanthamine derivative Drug Info [525746]
Allyl-trimethyl-ammonium Drug Info [534296]
Ambenonium Drug Info [536540]
Amocarzine Drug Info [526781]
AP-2238 Drug Info [530741]
AP-2243 Drug Info [529149]
BENZOQUINONE Drug Info [527510]
Beta-L-fucose Drug Info [551391]
BIS(12)-HUPERZINE B Drug Info [527419]
Bis(14)-Huperzine B Drug Info [527419]
BIS(16)-HUPERZINE B Drug Info [527419]
BIS(18)-HUPERZINE B Drug Info [527419]
BIS(20)-HUPERZINE B Drug Info [527419]
BIS(8)-HUPERZINE B Drug Info [527419]
BIS(9)-HUPERZINE B Drug Info [527419]
Bis-7-tacrine Drug Info [530923]
But-3-enyl-trimethyl-ammonium bromide Drug Info [534296]
BW-28C51 Drug Info [529716]
BW284C51 Drug Info [526592]
BZYX Drug Info [543634]
CAPROCTAMINE Drug Info [529775]
Caracemide Drug Info [533460]
Carinatumins B (2) Drug Info [528591]
CHF-2819 Drug Info [528371]
CHLORANIL Drug Info [527510]
Chlorphrifos oxon Drug Info [529440]
CHLORPYRIFOS Drug Info [527865]
CHOLINE IODIDE Drug Info [534296]
Cis-2,6-dimethyl-1-methyl sulfonyl piperidine Drug Info [530187]
CLEBOPRIDE Drug Info [527214]
CORONARIDINE Drug Info [531166]
CRYPTADINE B Drug Info [529072]
DECIDIUM Drug Info [529473]
Demecarium bromide Drug Info [535708], [537819]
Dimethyl-pent-4-enyl-ammonium bromide Drug Info [534296]
Edrophonium Drug Info [537001], [537124], [537383]
Eptastigmine Drug Info [526265]
Ethyl octylfluorophosphonate Drug Info [529440]
ETHYLPHENSERINE Drug Info [531080]
F-3796 Drug Info [545743]
FR-152558 Drug Info [546175]
Fucose Drug Info [551393]
Galantamine Drug Info [537334], [537340], [537434]
Galanthamine derivative Drug Info [529473]
GANSTIGMINE Drug Info [529473]
GENESERINE Drug Info [528371]
HALOXYSTEROL A Drug Info [527846]
HALOXYSTEROL B Drug Info [527846]
Haloxysterol C Drug Info [527846]
Haloxysterol D Drug Info [527846]
HEPTYPHYSOSTIGMINE Drug Info [531080]
Hexyl-trimethyl-ammonium Drug Info [534296]
HP-290 Drug Info [525471]
Huperaine A Drug Info [551374]
Huperzine A Drug Info [535553]
Huprine X Drug Info [529473]
Huprine Y Drug Info [530171]
Huprine-Tacrine Heterodimer Drug Info [527471]
Icopezil maleate Drug Info [527249]
INFRACTOPICRIN Drug Info [530743]
INM-176 Drug Info [531983]
Iso-OMPA Drug Info [529716]
Isoflurophate Drug Info [535756]
Isopropyl dodecylfluorophosphonate Drug Info [529440]
Isosorbide-2-(methylcarbamate)-5-benzoate Drug Info [529716]
Isosorbide-2-(methylcarbamate)-5-mononitrate Drug Info [529716]
Isosorbide-2-benzylcarbamate-5-cyclopentanoate Drug Info [529716]
Isosorbide-2-benzylcarbamate-5-cyclopropanoate Drug Info [529716]
Isosorbide-2-benzylcarbamate-5-tosylate Drug Info [529716]
Isosorbide-di-(4-nitrophenyl carbamate) Drug Info [530646]
Isosorbide-di-(benzylcarbamate) Drug Info [530646]
Isosorbide-di-(ethylcarbamate) Drug Info [530646]
Isosorbide-di-phenylcarbamate Drug Info [530646]
KW-5092 Drug Info [534378]
Ladostigil Drug Info [531772]
LAWSARITOL Drug Info [527846]
LIPOCRINE Drug Info [530437]
LYSICAMINE Drug Info [551369]
Malathion Drug Info [537332]
MEMOQUIN Drug Info [530437]
MESUAGENIN A Drug Info [531213]
MESUAGENIN B Drug Info [531213]
Mesuagenin D Drug Info [531213]
Methanesulfonyl fluoride Drug Info [532098]
Methyl Phosphinic Acid Drug Info [551393]
Methylphosphonic Acid Ester Group Drug Info [551393]
MF-8615 Drug Info [546216]
MF268 Drug Info [551374]
Monoisopropylphosphorylserine Drug Info [551393]
N,N'-(1',10'-decylene)-bis-(-)-nor-MEP Drug Info [529368]
N,N'-(1',11'-undecydene)-bis-(-)-nor-MEP Drug Info [529368]
N,N'-(1',12'-dodecydene)-bis-(-)-nor-MEP Drug Info [529368]
N,N'-(1',5'-pentylene)-bis-(-)-nor-MEP Drug Info [529368]
N,N'-(1',6-hexylene)-bis-(-)-nor-MEP Drug Info [529368]
N,N'-(1',7'-heptylene)-bis-(-)-nor-MEP Drug Info [529368]
N,N'-(1',8'-octylene)-bis-(-)-nor-MEP Drug Info [529368]
N,N'-(1',9'-nonylene)-bis-(-)-nor-MEP Drug Info [529368]
N-(14-methylallyl)norgalanthamine Drug Info [529384]
N-ALLYLNORGALANTHAMINE Drug Info [529384]
N-allylnorlitebamine Drug Info [534555]
N-benzyl-2-(pyrrolidin-1-yl)pyrimidin-4-amine Drug Info [530923]
N-benzyl-2-morpholinopyrimidin-4-amine Drug Info [530923]
N-benzyl-2-thiomorpholinopyrimidin-4-amine Drug Info [530923]
N-benzylnorlitebamine Drug Info [534555]
N-butylnorlitebamine Drug Info [534555]
N-isobutylnorlitebamine Drug Info [534555]
N-isopropylnorlitebamine Drug Info [534555]
N-isopropylnorlitebamineN-methoiodide Drug Info [534555]
N-Methyl-1'H-phenothiazine-1'-carboxamide Drug Info [530749]
N-n-dodecyl-7-methoxytacrine hydrochloride Drug Info [531150]
N-n-heptyl-7-methoxytacrine hydrochloride Drug Info [531150]
N-n-hexyl-7-methoxytacrine hydrochloride Drug Info [531150]
N-n-nonyl-7-methoxytacrine hydrochloride Drug Info [531150]
N-n-octyl-7-methoxytacrine hydrochloride Drug Info [531150]
N-n-pentyl-7-methoxytacrine hydrochloride Drug Info [531150]
N-n-propyl-7-methoxytacrine hydrochloride Drug Info [531150]
N-phenethyl-2-(pyrrolidin-1-yl)pyrimidin-4-amine Drug Info [530923]
N-propylnorlitebamine Drug Info [534555]
Neostigmine Drug Info [537124], [537383]
NP-61 Drug Info [525350]
NP-7557 Drug Info [547587]
NSC-23180 Drug Info [529103]
OBIDOXIME Drug Info [527865]
PARAOXON Drug Info [529440]
Petrosamine Drug Info [529521]
PHENSERINE TARTRATE Drug Info [527603], [551871]
Physostigmine Drug Info [533483]
Propidium Drug Info [551393]
PRX-105 Drug Info [533264]
Pseudocolumbamine trifluoroacetate Drug Info [551369]
Pseudopalmatine trifluoroacetate Drug Info [551369]
Pyridostigmine Drug Info [537124]
QUILOSTIGMINE Drug Info [531080]
R-phenserine Drug Info [527603]
Ro-46-5934 Drug Info [533753]
S-9977 Drug Info [526803]
SM-10888 Drug Info [532426]
SPH-1285 Drug Info [525994]
T-82 Drug Info [526578], [551871]
Tacrine Drug Info [535519]
TACRINE(8)-4-AMINOQUINOLINE Drug Info [551374]
TAK-802 Drug Info [526952]
TASPINE Drug Info [528444]
TERRITREM B Drug Info [551363]
Tetraethylene Glycol Drug Info [551393]
THIOCTIC ACID Drug Info [529250]
TOLSERINE Drug Info [531080]
TRIMEDOXIME Drug Info [527865]
Trimethyl-(3-nitro-phenyl)-ammonium iodide Drug Info [534296]
Trimethyl-(4-oxo-pentyl)-ammonium iodide Drug Info [534296]
TURBINATINE Drug Info [527312]
VELNACRINE Drug Info [551238]
VOACANGINE Drug Info [531166]
XANTHOSTIGMINE Drug Info [534716]
Zanapezil Drug Info [527590]
ZIFROSILONE Drug Info [533665], [551871]
ZT-1 Drug Info [527018], [551871]
Modulator ABS-301 Drug Info [534501]
CI-1002 Drug Info [533784]
CP-126998 Drug Info
Desoxypeganine Drug Info [529540]
Donepezil Drug Info [543634]
Echothiophate Iodide Drug Info [556264]
NPRx-30 Drug Info [543634]
Pralidoxime Chloride Drug Info [556264]
Rivastigmine Drug Info [543634]
Suronacrine maleate Drug Info
YM443 Drug Info [551871]
Activator MMB-4 Drug Info [543634]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Glycerophospholipid metabolism
Cholinergic synapse
PANTHER Pathway Muscarinic acetylcholine receptor 1 and 3 signaling pathway
Muscarinic acetylcholine receptor 2 and 4 signaling pathway
Nicotinic acetylcholine receptor signaling pathway
Pathway Interaction Database ATF-2 transcription factor network
PathWhiz Pathway Phospholipid Biosynthesis
WikiPathways Monoamine Transport
Biogenic Amine Synthesis
Acetylcholine Synthesis
Integrated Pancreatic Cancer Pathway
References
Ref 522744ClinicalTrials.gov (NCT00948766) Effects of Rivastigmine Patch on Activities of Daily Living and Cognition in Patients With Severe Dementia of the Alzheimer's Type (ACTION) (Study Protocol CENA713DUS44, NCT00948766) and a 24 Week Open-label Extension to Study CENA713DUS44. U.S. National Institutes of Health.
Ref 522989ClinicalTrials.gov (NCT01093859) An Exploratory Phase 1 Microdose Study of PRX-105. U.S. National Institutes of Health.
Ref 523260ClinicalTrials.gov (NCT01245530) An Efficacy and Safety Study of INM-176 for the Treatment of Patients With Alzheimer Type Dementia. U.S. National Institutes of Health.
Ref 526265Eptastigmine: ten years of pharmacology, toxicology, pharmacokinetic, and clinical studies. CNS Drug Rev. 2001 Winter;7(4):369-86.
Ref 526578Effects of T-82, a novel acetylcholinesterase inhibitor, on impaired learning and memory in passive avoidance task in rats. Eur J Pharmacol. 2003 Mar 28;465(1-2):97-103.
Ref 527051Velnacrine for Alzheimer's disease. Cochrane Database Syst Rev. 2004;(2):CD004748.
Ref 529540Phase I clinical trial with desoxypeganine, a new cholinesterase and selective MAO-A inhibitor: tolerance and pharmacokinetics study of escalating single oral doses. Methods Find Exp Clin Pharmacol. 2008 Mar;30(2):141-7.
Ref 531772Ladostigil: a novel multimodal neuroprotective drug with cholinesterase and brain-selective monoamine oxidase inhibitory activities for Alzheimer's disease treatment. Curr Drug Targets. 2012 Apr;13(4):483-94.
Ref 532220Neurotrophic and neuroprotective actions of (-)- and (+)-phenserine, candidate drugs for Alzheimer's disease. PLoS One. 2013;8(1):e54887.
Ref 532328Phase I study on the pharmacokinetics and tolerance of ZT-1, a prodrug of huperzine A, for the treatment of Alzheimer's disease. Acta Pharmacol Sin. 2013 Jul;34(7):976-82.
Ref 533753A novel acetylcholinesterase inhibitor, Ro 46-5934, which interacts with muscarinic M2 receptors. Biochem Soc Trans. 1994 Aug;22(3):755-8.
Ref 533784PD 142676 (CI 1002), a novel anticholinesterase and muscarinic antagonist. Mol Neurobiol. 1994 Aug-Dec;9(1-3):93-106.
Ref 534378Oral administration of KW-5092, a novel gastroprokinetic agent with acetylcholinesterase inhibitory and acetylcholine release enhancing activities, causes a dose-dependent increase in the blood acetylcholine content of beagle dogs. Neurosci Lett. 1997 Mar 28;225(1):25-8.
Ref 534433The safety and efficacy of amocarzine in African onchocerciasis and the influence of ivermectin on the clinical and parasitological response to treatment. Ann Trop Med Parasitol. 1997 Apr;91(3):281-96.
Ref 536285Novel pharmacological targets for the treatment of Parkinson's disease. Nat Rev Drug Discov. 2006 Oct;5(10):845-54.
Ref 536300Anaesthetic drugs: linking molecular actions to clinical effects. Curr Pharm Des. 2006;12(28):3665-79.
Ref 536361Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20.
Ref 538168FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 040131.
Ref 538182FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 040457.
Ref 538333FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 078743.
Ref 538427FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 010155.
Ref 538451FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 011860.
Ref 538454FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 011963.
Ref 541716(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6598).
Ref 541717(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6599).
Ref 541722(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6602).
Ref 541792(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6687).
Ref 541798(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6693).
Ref 544707Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000687)
Ref 544726Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000740)
Ref 544850Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001320)
Ref 544878Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001402)
Ref 544962Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001724)
Ref 545006Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001855)
Ref 545741Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004496)
Ref 545742Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004498)
Ref 545830Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004958)
Ref 546136Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006532)
Ref 546140Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006556)
Ref 546174Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006757)
Ref 546215Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006922)
Ref 546251Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007119)
Ref 546262Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007171)
Ref 547033Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012344)
Ref 547351Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015422)
Ref 547586Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017551)
Ref 547886Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020145)
Ref 548049Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021506)
Ref 548783Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028783)
Ref 548786Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028816)
Ref 549186Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033430)
Ref 550269Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 551848Handbook of Dementing Illnesses, Morris John. Page(570).
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 525350Potent beta-amyloid modulators. Neurodegener Dis. 2008;5(3-4):153-6.
Ref 525471NXX-066 in patients with Alzheimer's disease: a bridging study. Life Sci. 1999;64(14):1215-21.
Ref 525746Bioorg Med Chem Lett. 2000 Apr 3;10(7):637-9.Potent acetylcholinesterase inhibitors: design, synthesis and structure-activity relationships of alkylene linked bis-galanthamine and galanthamine-galanthaminium salts.
Ref 525994Galantamine, a cholinesterase inhibitor that allosterically modulates nicotinic receptors: effects on the course of Alzheimer's disease. Biol Psychiatry. 2001 Feb 1;49(3):289-99.
Ref 526093Bioorg Med Chem Lett. 2001 Jul 9;11(13):1779-82.Novel and potent tacrine-related hetero- and homobivalent ligands for acetylcholinesterase and butyrylcholinesterase.
Ref 526149J Med Chem. 2001 Sep 27;44(20):3203-15.A structure-based design approach to the development of novel, reversible AChE inhibitors.
Ref 526265Eptastigmine: ten years of pharmacology, toxicology, pharmacokinetic, and clinical studies. CNS Drug Rev. 2001 Winter;7(4):369-86.
Ref 526578Effects of T-82, a novel acetylcholinesterase inhibitor, on impaired learning and memory in passive avoidance task in rats. Eur J Pharmacol. 2003 Mar 28;465(1-2):97-103.
Ref 526592Cholinesterases: new roles in brain function and in Alzheimer's disease. Neurochem Res. 2003 Apr;28(3-4):515-22.
Ref 526619Bioorg Med Chem Lett. 2003 May 19;13(10):1825-7.Synthesis, anticholinesterase activity and structure-activity relationships of m-Aminobenzoic acid derivatives.
Ref 526781Activity, mechanism of action and pharmacokinetics of 2-tert-butylbenzothiazole and CGP 6140 (amocarzine) antifilarial drugs. Acta Trop. 1992 Aug;51(3-4):195-211.
Ref 526803Xanthine derivatives IBMX and S-9977-2 potentiate transmission at an Aplysia central cholinergic synapse. Brain Res. 1992 Jul 17;586(1):78-85.
Ref 526952Effects of TAK-802, a novel acetylcholinesterase inhibitor, on distension-induced rhythmic bladder contractions in rats and guinea pigs. Eur J Pharmacol. 2004 Feb 6;485(1-3):299-305.
Ref 527018A sensitive method for the determination of the novel cholinesterase inhibitor ZT-1 and its active metabolite huperzine A in rat blood using liquid chromatography/tandem mass spectrometry. Rapid Commun Mass Spectrom. 2004;18(6):651-6.
Ref 527214J Med Chem. 2004 Sep 23;47(20):4818-28.Efficient method for high-throughput virtual screening based on flexible docking: discovery of novel acetylcholinesterase inhibitors.
Ref 527249J Med Chem. 2004 Oct 21;47(22):5492-500.A docking score function for estimating ligand-protein interactions: application to acetylcholinesterase inhibition.
Ref 527312J Nat Prod. 2004 Nov;67(11):1882-5.Indole glucoalkaloids from Chimarrhis turbinata and their evaluation as antioxidant agents and acetylcholinesterase inhibitors.
Ref 527419J Med Chem. 2005 Feb 10;48(3):655-7.Bis-huperzine B: highly potent and selective acetylcholinesterase inhibitors.
Ref 527471J Med Chem. 2005 Mar 24;48(6):1701-4.Synthesis and pharmacological evaluation of huprine-tacrine heterodimers: subnanomolar dual binding site acetylcholinesterase inhibitors.
Ref 527510J Med Chem. 2005 Apr 21;48(8):2906-15.Identification and characterization of novel benzil (diphenylethane-1,2-dione) analogues as inhibitors of mammalian carboxylesterases.
Ref 527590Effect of oral administration of zanapezil (TAK-147) for 21 days on acetylcholine and monoamines levels in the ventral hippocampus of freely moving rats. Br J Pharmacol. 2005 Aug;145(8):1035-44.
Ref 527603An overview of phenserine tartrate, a novel acetylcholinesterase inhibitor for the treatment of Alzheimer's disease. Curr Alzheimer Res. 2005 Jul;2(3):281-90.
Ref 527846Bioorg Med Chem Lett. 2006 Feb;16(3):573-80. Epub 2005 Nov 7.Isolation and cholinesterase-inhibition studies of sterols from Haloxylon recurvum.
Ref 527865Bioorg Med Chem Lett. 2006 Feb;16(3):622-7. Epub 2005 Nov 8.Synthesis of the novel series of bispyridinium compounds bearing (E)-but-2-ene linker and evaluation of their reactivation activity against chlorpyrifos-inhibited acetylcholinesterase.
Ref 528371J Med Chem. 2006 Aug 24;49(17):5051-8.Structural determinants of Torpedo californica acetylcholinesterase inhibition by the novel and orally active carbamate based anti-alzheimer drug ganstigmine (CHF-2819).
Ref 528402J Med Chem. 2006 Sep 7;49(18):5411-3.Homobivalent quinazolinimines as novel nanomolar inhibitors of cholinesterases with dirigible selectivity toward butyrylcholinesterase.
Ref 528415Bioorg Med Chem Lett. 2006 Nov 15;16(22):5840-3. Epub 2006 Sep 1.6-Hydroxy- and 6-methoxy-beta-carbolines as acetyl- and butyrylcholinesterase inhibitors.
Ref 528444J Nat Prod. 2006 Sep;69(9):1341-6.Taspine: bioactivity-guided isolation and molecular ligand-target insight of a potent acetylcholinesterase inhibitor from Magnolia x soulangiana.
Ref 528456Bioorg Med Chem. 2007 Jan 1;15(1):575-85. Epub 2006 Sep 27.Cholinesterase inhibitors: SAR and enzyme inhibitory activity of 3-[omega-(benzylmethylamino)alkoxy]xanthen-9-ones.
Ref 528564J Med Chem. 2006 Dec 14;49(25):7540-4.Novel heterobivalent tacrine derivatives as cholinesterase inhibitors with notable selectivity toward butyrylcholinesterase.
Ref 528570J Med Chem. 2006 Nov 16;49(23):6833-40.Binding of 13-amidohuprines to acetylcholinesterase: exploring the ligand-induced conformational change of the gly117-gly118 peptide bond in the oxyanion hole.
Ref 528591Bioorg Med Chem. 2007 Feb 15;15(4):1703-7. Epub 2006 Dec 15.Carinatumins A-C, new alkaloids from Lycopodium carinatum inhibiting acetylcholinesterase.
Ref 528897Eur J Med Chem. 2008 Jan;43(1):166-73. Epub 2007 Apr 5.Synthesis and biological evaluation of helicid analogues as novel acetylcholinesterase inhibitors.
Ref 528979Bioorg Med Chem. 2007 Oct 15;15(20):6596-607. Epub 2007 Jul 25.Synthesis, in vitro assay, and molecular modeling of new piperidine derivatives having dual inhibitory potency against acetylcholinesterase and Abeta1-42 aggregation for Alzheimer's disease therapeutics.
Ref 529072Bioorg Med Chem. 2007 Dec 15;15(24):7803-8. Epub 2007 Aug 28.Cryptadines A and B, novel C27N3-type pentacyclic alkaloids from Lycopodium cryptomerinum.
Ref 529103J Med Chem. 2007 Nov 15;50(23):5727-34. Epub 2007 Oct 17.Planarity and constraint of the carbonyl groups in 1,2-diones are determinants for selective inhibition of human carboxylesterase 1.
Ref 529149Bioorg Med Chem Lett. 2008 Jan 1;18(1):423-6. Epub 2007 Oct 4.Multi-target-directed coumarin derivatives: hAChE and BACE1 inhibitors as potential anti-Alzheimer compounds.
Ref 529250J Med Chem. 2008 Feb 14;51(3):347-72. Epub 2008 Jan 9.Multi-target-directed ligands to combat neurodegenerative diseases.
Ref 529368J Med Chem. 2008 Apr 10;51(7):2027-36. Epub 2008 Mar 12.Bis-(-)-nor-meptazinols as novel nanomolar cholinesterase inhibitors with high inhibitory potency on amyloid-beta aggregation.
Ref 529384Bioorg Med Chem Lett. 2008 Apr 1;18(7):2263-6. Epub 2008 Mar 7.N-Alkylated galanthamine derivatives: Potent acetylcholinesterase inhibitors from Leucojum aestivum.
Ref 529440Nat Chem Biol. 2008 Jun;4(6):373-8. Epub 2008 Apr 27.Activation of the endocannabinoid system by organophosphorus nerve agents.
Ref 529473J Med Chem. 2008 Jun 12;51(11):3154-70. Epub 2008 May 15.Exploiting protein fluctuations at the active-site gorge of human cholinesterases: further optimization of the design strategy to develop extremely potent inhibitors.
Ref 529521Bioorg Med Chem. 2008 Jul 1;16(13):6560-7. Epub 2008 May 15.Petrosamine, a potent anticholinesterase pyridoacridine alkaloid from a Thai marine sponge Petrosia n. sp.
Ref 529540Phase I clinical trial with desoxypeganine, a new cholinesterase and selective MAO-A inhibitor: tolerance and pharmacokinetics study of escalating single oral doses. Methods Find Exp Clin Pharmacol. 2008 Mar;30(2):141-7.
Ref 529567Bioorg Med Chem. 2008 Aug 1;16(15):7450-6. Epub 2008 Jun 14.Homo- and hetero-bivalent edrophonium-like ammonium salts as highly potent, dual binding site AChE inhibitors.
Ref 529641Bioorg Med Chem. 2008 Sep 1;16(17):8011-21. Epub 2008 Jul 29.Design, synthesis, and acetylcholinesterase inhibitory activity of novel coumarin analogues.
Ref 529716J Med Chem. 2008 Oct 23;51(20):6400-9. Epub 2008 Sep 26.Isosorbide-2-carbamate esters: potent and selective butyrylcholinesterase inhibitors.
Ref 529775J Med Chem. 2008 Nov 27;51(22):7308-12.Structure-activity relationships of acetylcholinesterase noncovalent inhibitors based on a polyamine backbone. 4. Further investigation on the inner spacer.
Ref 529985Eur J Med Chem. 2009 Jun;44(6):2523-32. Epub 2009 Jan 31.Synthesis, biological evaluation and molecular modeling of oxoisoaporphine and oxoaporphine derivatives as new dual inhibitors of acetylcholinesterase/butyrylcholinesterase.
Ref 530171Bioorg Med Chem. 2009 Jul 1;17(13):4523-36. Epub 2009 May 8.Synthesis and structure-activity relationship of Huprine derivatives as human acetylcholinesterase inhibitors.
Ref 530187Eur J Med Chem. 2009 Oct;44(10):4057-62. Epub 2009 May 8.Active site directed docking studies: synthesis and pharmacological evaluation of cis-2,6-dimethyl piperidine sulfonamides as inhibitors of acetylcholinesterase.
Ref 530301J Med Chem. 2009 Sep 10;52(17):5365-79.Pyrano[3,2-c]quinoline-6-chlorotacrine hybrids as a novel family of acetylcholinesterase- and beta-amyloid-directed anti-Alzheimer compounds.
Ref 530437J Med Chem. 2009 Dec 10;52(23):7883-6.Toward a rational design of multitarget-directed antioxidants: merging memoquin and lipoic acid molecular frameworks.
Ref 530551Eur J Med Chem. 2010 Feb;45(2):526-35. Epub 2009 Nov 10.Synthesis and AChE inhibitory activity of new chiral tetrahydroacridine analogues from terpenic cyclanones.
Ref 530625Bioorg Med Chem. 2010 Feb;18(3):1244-51. Epub 2009 Dec 16.Synthesis, biological evaluation, and molecular modeling of berberine derivatives as potent acetylcholinesterase inhibitors.
Ref 530639Eur J Med Chem. 2010 Apr;45(4):1415-23. Epub 2010 Jan 4.Synthesis and evaluation of novel rutaecarpine derivatives and related alkaloids derivatives as selective acetylcholinesterase inhibitors.
Ref 530646Bioorg Med Chem. 2010 Feb;18(3):1045-53. Epub 2010 Jan 6.Isosorbide-based cholinesterase inhibitors; replacement of 5-ester groups leading to increased stability.
Ref 530692Bioorg Med Chem Lett. 2010 Mar 1;20(5):1718-20. Epub 2010 Jan 20.Design, synthesis, evaluation and QSAR analysis of N(1)-substituted norcymserine derivatives as selective butyrylcholinesterase inhibitors.
Ref 530696Bioorg Med Chem Lett. 2010 Mar 1;20(5):1763-6. Epub 2010 Jan 20.Preparation and in vitro screening of symmetrical bispyridinium cholinesterase inhibitors bearing different connecting linkage-initialstudy for Myasthenia gravis implications.
Ref 530741Bioorg Med Chem. 2010 Mar 1;18(5):1749-60. Epub 2010 Feb 4.Targeting Alzheimer's disease: Novel indanone hybrids bearing a pharmacophoric fragment of AP2238.
Ref 530743Bioorg Med Chem. 2010 Mar 15;18(6):2173-7. Epub 2010 Feb 4.Acetylcholinesterase inhibitors from the toadstool Cortinarius infractus.
Ref 530749Bioorg Med Chem. 2010 Mar 15;18(6):2232-44. Epub 2010 Feb 4.Differential binding of phenothiazine urea derivatives to wild-type human cholinesterases and butyrylcholinesterase mutants.
Ref 530824J Med Chem. 2010 May 13;53(9):3611-7.Bivalent beta-carbolines as potential multitarget anti-Alzheimer agents.
Ref 530920Bioorg Med Chem. 2010 Jun 15;18(12):4475-84. Epub 2010 Apr 27.Synthesis and biological evaluation of a new series of berberine derivatives as dual inhibitors of acetylcholinesterase and butyrylcholinesterase.
Ref 530923Bioorg Med Chem Lett. 2010 Jun 15;20(12):3606-9. Epub 2010 Apr 28.Design, synthesis and evaluation of 2,4-disubstituted pyrimidines as cholinesterase inhibitors.
Ref 531079J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential.
Ref 531080J Med Chem. 2010 Sep 9;53(17):6490-505.Novel carbamates as orally active acetylcholinesterase inhibitors found to improve scopolamine-induced cognition impairment: pharmacophore-based virtual screening, synthesis, and pharmacology.
Ref 531150Bioorg Med Chem Lett. 2010 Oct 15;20(20):6093-5. Epub 2010 Aug 16.Synthesis and in vitro evaluation of N-alkyl-7-methoxytacrine hydrochlorides as potential cholinesterase inhibitors in Alzheimer disease.
Ref 531166Bioorg Med Chem Lett. 2010 Nov 1;20(21):6185-7. Epub 2010 Aug 31.Indole alkaloids from Ervatamia hainanensis with potent acetylcholinesterase inhibition activities.
Ref 531213Bioorg Med Chem. 2010 Nov 15;18(22):7873-7. Epub 2010 Sep 25.4-Phenylcoumarins from Mesua elegans with acetylcholinesterase inhibitory activity.
Ref 531772Ladostigil: a novel multimodal neuroprotective drug with cholinesterase and brain-selective monoamine oxidase inhibitory activities for Alzheimer's disease treatment. Curr Drug Targets. 2012 Apr;13(4):483-94.
Ref 531983The memory ameliorating effects of INM-176, an ethanolic extract of Angelica gigas, against scopolamine- or Abeta(1-42)-induced cognitive dysfunction in mice. J Ethnopharmacol. 2012 Sep 28;143(2):611-20.
Ref 532098A randomized phase I study of methanesulfonyl fluoride, an irreversible cholinesterase inhibitor, for the treatment of Alzheimer's disease. Br J Clin Pharmacol. 2013 May;75(5):1231-9.
Ref 532426Pharmacological and biochemical assessment of SM-10888, a novel cholinesterase inhibitor. Jpn J Pharmacol. 1990 Jun;53(2):145-55.
Ref 533264Preclinical and first-in-human evaluation of PRX-105, a PEGylated, plant-derived, recombinant human acetylcholinesterase-R. Toxicol Appl Pharmacol. 2015 Sep 15;287(3):202-9.
Ref 533460Biochemical pharmacology of N-acetyl-N-(methylcarbamoyloxy)-N'-methylurea (caracemide; NSC-253272). Biochem Pharmacol. 1986 Aug 15;35(16):2781-7.
Ref 533483The effects of physostigmine on acetylcholinesterase activity of CSF plasma and brain. A comparison of intravenous and intraventricular administration in beagle dogs. Neuropharmacology. 1986 Oct;25(10):1167-77.
Ref 533665Acetylcholinesterase inhibition by zifrosilone: pharmacokinetics and pharmacodynamics. Clin Pharmacol Ther. 1995 Jul;58(1):54-61.
Ref 533753A novel acetylcholinesterase inhibitor, Ro 46-5934, which interacts with muscarinic M2 receptors. Biochem Soc Trans. 1994 Aug;22(3):755-8.
Ref 533784PD 142676 (CI 1002), a novel anticholinesterase and muscarinic antagonist. Mol Neurobiol. 1994 Aug-Dec;9(1-3):93-106.
Ref 534296J Med Chem. 1996 Dec 20;39(26):5064-71.Structure-based alignment and comparative molecular field analysis of acetylcholinesterase inhibitors.
Ref 534378Oral administration of KW-5092, a novel gastroprokinetic agent with acetylcholinesterase inhibitory and acetylcholine release enhancing activities, causes a dose-dependent increase in the blood acetylcholine content of beagle dogs. Neurosci Lett. 1997 Mar 28;225(1):25-8.
Ref 534457J Nat Prod. 1997 Aug;60(8):842-3.Structure and anti-acetylcholinesterase activity of 4 alpha-(hydroxymethyl)-4 alpha-demethylterritrem B.
Ref 534501Novel tacrine analogues for potential use against Alzheimer's disease: potent and selective acetylcholinesterase inhibitors and 5-HT uptake inhibitors. J Med Chem. 1997 Oct 24;40(22):3516-23.
Ref 534555J Nat Prod. 1998 Jan;61(1):46-50.Litebamine N-homologues: preparation and anti-acetylcholinesterase activity.
Ref 534716J Med Chem. 1998 Oct 8;41(21):3976-86.Acetylcholinesterase inhibitors: synthesis and structure-activity relationships of omega-[N-methyl-N-(3-alkylcarbamoyloxyphenyl)- methyl]aminoalkoxyheteroaryl derivatives.
Ref 535519Evidence that the clinical effects of cholinesterase inhibitors are related to potency and targeting of action. Int J Clin Pract Suppl. 2002 Jun;(127):6-19.
Ref 535553Huperzine A attenuates cognitive deficits and brain injury in neonatal rats after hypoxia-ischemia. Brain Res. 2002 Sep 13;949(1-2):162-70.
Ref 535708The effects of topical ocular application of 0.25% demecarium bromide on serum acetylcholinesterase levels in normal dogs. Vet Ophthalmol. 2003 Mar;6(1):23-5.
Ref 535756Rational design of alkylene-linked bis-pyridiniumaldoximes as improved acetylcholinesterase reactivators. Chem Biol. 2003 Jun;10(6):491-502.
Ref 536540Alpha6-containing nicotinic acetylcholine receptors dominate the nicotine control of dopamine neurotransmission in nucleus accumbens. Neuropsychopharmacology. 2008 Aug;33(9):2158-66. Epub 2007 Nov 21.
Ref 537001Stabilization of Torpedo californica acetylcholinesterase by reversible inhibitors. Biochemistry. 2009 Jan 27;48(3):563-74.
Ref 537124Neuromuscular blockade, reversal agent use, and operating room time: retrospective analysis of US inpatient surgeries. Curr Med Res Opin. 2009 Apr;25(4):943-50.
Ref 537332Acetylcholinesterase activity in Corbicula fluminea Mull., as a biomarker of organophosphate pesticide pollution in Pinacanauan River, Philippines. Environ Monit Assess. 2009 May 12.
Ref 537334Effects of cholinesterase inhibition on brain white matter volume in Alzheimer's disease. Neuroreport. 2009 Feb 18;20(3):285-8.
Ref 537340Acetylcholinesterase inhibitors enhance cognitive functions in rats following hypobaric hypoxia. Behav Brain Res. 2009 Oct 12;203(1):1-14. Epub 2009 Mar 28.
Ref 537383Screening of acetylcholinesterase inhibitors by CE after enzymatic reaction at capillary inlet. J Sep Sci. 2009 May;32(10):1748-56.
Ref 537434From symptomatic to disease modifying therapy? Recent developments in the pharmacotherapy of Alzheimer's disease. Fortschr Neurol Psychiatr. 2009 Jun;77(6):326-33. Epub 2009 Jun 5.
Ref 537819Neuromuscular blocking agents and axial teratogenesis in the avian embryo. Can axial morphogenetic disorders by explained by pharmacological action upon muscle tissue? Teratology. 1981 Apr;23(2):259-71.
Ref 543634(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2465).
Ref 545743Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004498)
Ref 546175Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006757)
Ref 546216Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006922)
Ref 547587Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017551)
Ref 551218Long-acting anticholinesterases for myasthenia gravis: synthesis and activities of quaternary phenylcarbamates of neostigmine, pyridostigmine and physostigmine. Bioorg Med Chem. 2010 Jul 1;18(13):4687-93. doi: 10.1016/j.bmc.2010.05.022. Epub 2010 May 12.
Ref 551237The synthesis and in vitro acetylcholinesterase and butyrylcholinesterase inhibitory activity of tacrine (Cognex?) derivaties, Bioorg. Med. Chem. Lett. 2(8):861-864 (1992).
Ref 551238Synthesis and biological activity of putative mono-hydroxylated metabolites of velnacrine, Bioorg. Med. Chem. Lett. 2(8):865-870 (1992).
Ref 551277Acetylcholinesterase inhibition by alkaloids of the ant's venom Monomorium minutum, Bioorg. Med. Chem. Lett. 5(11):1131-1132 (1995).
Ref 551363Acetylcholinesterase inhibition by territrem B derivatives. J Nat Prod. 1995 Jun;58(6):857-62.
Ref 551369Characterization of Acetylcholinesterase Inhibitory Constituents from Annona glabra Assisted by HPLC Microfractionation. J Nat Prod. 2010 Oct 22;73(10):1632-5. doi: 10.1021/np100247r. Epub 2010 Sep 9.
Ref 551374The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
Ref 551391DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-4. Nucleic Acids Res. 2011 January
Ref 551393How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 556264Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
Ref 1587926URL: https://www.ebi.ac.uk/chembl/ The ChEMBL database in 2017

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.