Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T46700
|
||||
Former ID |
TTDR01388
|
||||
Target Name |
mRNA of human cot oncogene
|
||||
Gene Name |
MAP3K8
|
||||
Synonyms |
Cancer Osaka thyroid oncogene (mRNA); MAP3K8 (mRNA); Mitogenactivated protein kinase kinase kinase 8 (mRNA); Protooncogene cCot (mRNA); Serine/threonineprotein kinase cot (mRNA); TPL2 (mRNA); Tumor progression locus 2 (mRNA); MAP3K8
|
||||
Target Type |
Research
|
||||
Function |
Required for lipopolysaccharide (LPS)-induced, TLR4- mediated activation of the MAPK/ERK pathway in macrophages, thus being critical for production of the proinflammatory cytokine TNF- alpha (TNF) during immune responses. Involved in the regulation of T-helper cell differentiation and IFNG expression in T-cells. Involved in mediating host resistance to bacterial infection through negative regulation of type I interferon (IFN) production. In vitro, activates MAPK/ERK pathway in response to IL1 in an IRAK1-independent manner, leading to up-regulation of IL8 and CCL4. Transduces CD40 and TNFRSF1A signals that activate ERK in B- cells andmacrophages, and thus may play a role in the regulation of immunoglobulin production. May also play a role in the transduction of TNF signals that activate JNK and NF-kappa-B in some cell types. In adipocytes, activates MAPK/ERK pathway in an IKBKB-dependent manner in response to IL1B and TNF, but not insulin, leading to induction of lipolysis. Plays a role in the cell cycle. Isoform 1 shows sometransforming activity, although it is much weaker than that of the activated oncogenic variant.
|
||||
BioChemical Class |
Kinase
|
||||
Target Validation |
T46700
|
||||
UniProt ID | |||||
EC Number |
EC 2.7.11.25
|
||||
Sequence |
MEYMSTGSDNKEEIDLLIKHLNVSDVIDIMENLYASEEPAVYEPSLMTMCQDSNQNDERS
KSLLLSGQEVPWLSSVRYGTVEDLLAFANHISNTAKHFYGQRPQESGILLNMVITPQNGR YQIDSDVLLIPWKLTYRNIGSDFIPRGAFGKVYLAQDIKTKKRMACKLIPVDQFKPSDVE IQACFRHENIAELYGAVLWGETVHLFMEAGEGGSVLEKLESCGPMREFEIIWVTKHVLKG LDFLHSKKVIHHDIKPSNIVFMSTKAVLVDFGLSVQMTEDVYFPKDLRGTEIYMSPEVIL CRGHSTKADIYSLGATLIHMQTGTPPWVKRYPRSAYPSYLYIIHKQAPPLEDIADDCSPG MRELIEASLERNPNHRPRAADLLKHEALNPPREDQPRCQSLDSALLERKRLLSRKELELP ENIADSSCTGSTEESEMLKRQRSLYIDLGALAGYFNLVRGPPTLEYG |
||||
Pathways | |||||
KEGG Pathway | MAPK signaling pathway | ||||
Toll-like receptor signaling pathway | |||||
T cell receptor signaling pathway | |||||
TNF signaling pathway | |||||
NetPath Pathway | TCR Signaling Pathway | ||||
PANTHER Pathway | Toll receptor signaling pathway | ||||
Pathway Interaction Database | TCR signaling in na& | ||||
#xef | |||||
ve CD4+ T cells | |||||
TCR signaling in na& | |||||
ve CD8+ T cells | |||||
Role of Calcineurin-dependent NFAT signaling in lymphocytes | |||||
Ras signaling in the CD4+ TCR pathway | |||||
JNK signaling in the CD4+ TCR pathway | |||||
Reactome | CD28 dependent PI3K/Akt signaling | ||||
MAP3K8 (TPL2)-dependent MAPK1/3 activation | |||||
WikiPathways | Toll-like receptor signaling pathway | ||||
TCR Signaling Pathway | |||||
Insulin Signaling | |||||
MAPK Signaling Pathway | |||||
Structural Pathway of Interleukin 1 (IL-1) | |||||
TNF alpha Signaling Pathway | |||||
miR-targeted genes in squamous cell - TarBase | |||||
miR-targeted genes in lymphocytes - TarBase | |||||
miR-targeted genes in leukocytes - TarBase | |||||
miR-targeted genes in epithelium - TarBase | |||||
Interleukin-1 signaling | |||||
Costimulation by the CD28 family | |||||
Regulation of toll-like receptor signaling pathway | |||||
References | |||||
Ref 527741 | Inhibition of Tpl2 kinase and TNF-alpha production with 1,7-naphthyridine-3-carbonitriles: synthesis and structure-activity relationships. Bioorg Med Chem Lett. 2005 Dec 1;15(23):5288-92. Epub 2005 Sep 13. | ||||
Ref 529035 | J Biol Chem. 2007 Nov 16;282(46):33295-304. Epub 2007 Sep 11.Pharmacologic inhibition of tpl2 blocks inflammatory responses in primary human monocytes, synoviocytes, and blood. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.