Target General Infomation
Target ID
T46700
Former ID
TTDR01388
Target Name
mRNA of human cot oncogene
Gene Name
MAP3K8
Synonyms
Cancer Osaka thyroid oncogene (mRNA); MAP3K8 (mRNA); Mitogenactivated protein kinase kinase kinase 8 (mRNA); Protooncogene cCot (mRNA); Serine/threonineprotein kinase cot (mRNA); TPL2 (mRNA); Tumor progression locus 2 (mRNA); MAP3K8
Target Type
Research
Function
Required for lipopolysaccharide (LPS)-induced, TLR4- mediated activation of the MAPK/ERK pathway in macrophages, thus being critical for production of the proinflammatory cytokine TNF- alpha (TNF) during immune responses. Involved in the regulation of T-helper cell differentiation and IFNG expression in T-cells. Involved in mediating host resistance to bacterial infection through negative regulation of type I interferon (IFN) production. In vitro, activates MAPK/ERK pathway in response to IL1 in an IRAK1-independent manner, leading to up-regulation of IL8 and CCL4. Transduces CD40 and TNFRSF1A signals that activate ERK in B- cells andmacrophages, and thus may play a role in the regulation of immunoglobulin production. May also play a role in the transduction of TNF signals that activate JNK and NF-kappa-B in some cell types. In adipocytes, activates MAPK/ERK pathway in an IKBKB-dependent manner in response to IL1B and TNF, but not insulin, leading to induction of lipolysis. Plays a role in the cell cycle. Isoform 1 shows sometransforming activity, although it is much weaker than that of the activated oncogenic variant.
BioChemical Class
Kinase
Target Validation
T46700
UniProt ID
EC Number
EC 2.7.11.25
Sequence
MEYMSTGSDNKEEIDLLIKHLNVSDVIDIMENLYASEEPAVYEPSLMTMCQDSNQNDERS
KSLLLSGQEVPWLSSVRYGTVEDLLAFANHISNTAKHFYGQRPQESGILLNMVITPQNGR
YQIDSDVLLIPWKLTYRNIGSDFIPRGAFGKVYLAQDIKTKKRMACKLIPVDQFKPSDVE
IQACFRHENIAELYGAVLWGETVHLFMEAGEGGSVLEKLESCGPMREFEIIWVTKHVLKG
LDFLHSKKVIHHDIKPSNIVFMSTKAVLVDFGLSVQMTEDVYFPKDLRGTEIYMSPEVIL
CRGHSTKADIYSLGATLIHMQTGTPPWVKRYPRSAYPSYLYIIHKQAPPLEDIADDCSPG
MRELIEASLERNPNHRPRAADLLKHEALNPPREDQPRCQSLDSALLERKRLLSRKELELP
ENIADSSCTGSTEESEMLKRQRSLYIDLGALAGYFNLVRGPPTLEYG
Inhibitor 8-chloro-quinoline-3-carbonitrile Drug Info [529035]
NSC-686549 Drug Info [529213]
Tpl2 kinase inhibitor Drug Info [527741]
Pathways
KEGG Pathway MAPK signaling pathway
Toll-like receptor signaling pathway
T cell receptor signaling pathway
TNF signaling pathway
NetPath Pathway TCR Signaling Pathway
PANTHER Pathway Toll receptor signaling pathway
Pathway Interaction Database TCR signaling in na&amp
#xef
ve CD4+ T cells
TCR signaling in na&amp
ve CD8+ T cells
Role of Calcineurin-dependent NFAT signaling in lymphocytes
Ras signaling in the CD4+ TCR pathway
JNK signaling in the CD4+ TCR pathway
Reactome CD28 dependent PI3K/Akt signaling
MAP3K8 (TPL2)-dependent MAPK1/3 activation
WikiPathways Toll-like receptor signaling pathway
TCR Signaling Pathway
Insulin Signaling
MAPK Signaling Pathway
Structural Pathway of Interleukin 1 (IL-1)
TNF alpha Signaling Pathway
miR-targeted genes in squamous cell - TarBase
miR-targeted genes in lymphocytes - TarBase
miR-targeted genes in leukocytes - TarBase
miR-targeted genes in epithelium - TarBase
Interleukin-1 signaling
Costimulation by the CD28 family
Regulation of toll-like receptor signaling pathway
References
Ref 527741Inhibition of Tpl2 kinase and TNF-alpha production with 1,7-naphthyridine-3-carbonitriles: synthesis and structure-activity relationships. Bioorg Med Chem Lett. 2005 Dec 1;15(23):5288-92. Epub 2005 Sep 13.
Ref 529035J Biol Chem. 2007 Nov 16;282(46):33295-304. Epub 2007 Sep 11.Pharmacologic inhibition of tpl2 blocks inflammatory responses in primary human monocytes, synoviocytes, and blood.
Ref 529213Proc Natl Acad Sci U S A. 2007 Dec 18;104(51):20523-8. Epub 2007 Dec 11.A systematic interaction map of validated kinase inhibitors with Ser/Thr kinases.
Ref 549638US patent application no. 6,265,216, Antisense modulation of cot oncogene expression.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.