Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T63986
|
||||
Former ID |
TTDC00339
|
||||
Target Name |
mRNA of kinesin spindle protein
|
||||
Gene Name |
KIF11
|
||||
Synonyms |
mRNA of KIF11; mRNA of Kinesin-like protein 1; mRNA of Kinesin-like protein KIF11; mRNA of Kinesin-like spindle protein HKSP; mRNA of Kinesin-related motor protein Eg5; mRNA of TR-interacting protein 5; mRNA of TRIP-5; mRNA of Thyroid receptor-interacting protein 5; KIF11
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Hematological malignancies [ICD9: 200-209; ICD10: C81-C86] | ||||
Liver cancer [ICD9: 140-229, 155, 203.0; ICD10: C22] | |||||
Function |
Motor protein required for establishing a bipolar spindle. Blocking of KIF11 prevents centrosome migration and arrest cells in mitosis with monoastral microtubule arrays.
|
||||
BioChemical Class |
Kinesin-like protein family
|
||||
Target Validation |
T37756
|
||||
UniProt ID | |||||
Sequence |
MASQPNSSAKKKEEKGKNIQVVVRCRPFNLAERKASAHSIVECDPVRKEVSVRTGGLADK
SSRKTYTFDMVFGASTKQIDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERS PNEEYTWEEDPLAGIIPRTLHQIFEKLTDNGTEFSVKVSLLEIYNEELFDLLNPSSDVSE RLQMFDDPRNKRGVIIKGLEEITVHNKDEVYQILEKGAAKRTTAATLMNAYSSRSHSVFS VTIHMKETTIDGEELVKIGKLNLVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRVIT ALVERTPHVPYRESKLTRILQDSLGGRTRTSIIATISPASLNLEETLSTLEYAHRAKNIL NKPEVNQKLTKKALIKEYTEEIERLKRDLAAAREKNGVYISEENFRVMSGKLTVQEEQIV ELIEKIGAVEEELNRVTELFMDNKNELDQCKSDLQNKTQELETTQKHLQETKLQLVKEEY ITSALESTEEKLHDAASKLLNTVEETTKDVSGLHSKLDRKKAVDQHNAEAQDIFGKNLNS LFNNMEELIKDGSSKQKAMLEVHKTLFGNLLSSSVSALDTITTVALGSLTSIPENVSTHV SQIFNMILKEQSLAAESKTVLQELINVLKTDLLSSLEMILSPTVVSILKINSQLKHIFKT SLTVADKIEDQKKELDGFLSILCNNLHELQENTICSLVESQKQCGNLTEDLKTIKQTHSQ ELCKLMNLWTERFCALEEKCENIQKPLSSVQENIQQKSKDIVNKMTFHSQKFCADSDGFS QELRNFNQEGTKLVEESVKHSDKLNGNLEKISQETEQRCESLNTRTVYFSEQWVSSLNER EQELHNLLEVVSQCCEASSSDITEKSDGRKAAHEKQHNIFLDQMTIDEDKLIAQNLELNE TIKIGLTKLNCFLEQDLKLDIPTGTTPQRKSYLYPSTLVRTEPREHLLDQLKRKQPELLM MLNCSENNKEETIPDVDVEEAVLGQYTEEPLSQEPSVDAGVDCSSIGGVPFFQHKKSHGK DKENRGINTLERSKVEETTEHLVTKSRLPLRAQINL |
||||
Structure |
1II6; 1Q0B; 1X88; 1YRS; 2FKY; 2FL2; 2FL6; 2FME; 2G1Q; 2GM1; 2IEH; 2PG2; 2Q2Y; 2Q2Z; 2UYI; 2UYM; 2WOG; 2X2R; 2X7C; 2X7D; 2X7E; 2XAE; 3CJO; 3HQD; 3K3B; 3K5E; 3KEN; 3L9H; 3ZCW; 4A1Z; 4A28; 4A50; 4A51; 4A5Y; 4AP0; 4AQV; 4AQW; 4AS7; 4B7B; 4BBG; 4BXN; 4CK5; 4CK6; 4CK7
|
||||
Drugs and Mode of Action | |||||
Inhibitor | (S)-dimethylenastron | Drug Info | [531008] | ||
(S)-enastron | Drug Info | [531008] | |||
1-(7-methyl-9H-carbazol-3-yl)ethanone | Drug Info | [530951] | |||
1-(trifluoromethyl)-9H-carbazole | Drug Info | [530951] | |||
1-tert-butyl-9H-carbazole | Drug Info | [530951] | |||
11H-benzo[a]carbazole | Drug Info | [530951] | |||
2,3,4,11-tetrahydro-1H-benzo[a]carbazole | Drug Info | [530951] | |||
2-(difluoromethyl)-9H-carbazole | Drug Info | [530951] | |||
2-(trifluoromethoxy)-9H-carbazole | Drug Info | [530951] | |||
2-(trifluoromethyl)-9H-carbazole | Drug Info | [530951] | |||
2-ethyl-9H-carbazole | Drug Info | [530951] | |||
2-isopropyl-9H-carbazole | Drug Info | [530951] | |||
2-methyl-6-(trifluoromethyl)-9H-carbazole | Drug Info | [530951] | |||
2-methyl-9H-carbazole | Drug Info | [530951] | |||
2-tert-butoxy-9H-carbazole | Drug Info | [530951] | |||
2-tert-butyl-7-(trifluoromethyl)-9H-carbazole | Drug Info | [530951] | |||
2-tert-butyl-9H-carbazole | Drug Info | [530951] | |||
3-(trifluoromethyl)-9H-carbazole | Drug Info | [530951] | |||
3-methyl-6-(trifluoromethyl)-9H-carbazole | Drug Info | [530951] | |||
3-tert-butyl-9H-carbazole | Drug Info | [530951] | |||
4'-(trifluoromethyl)-4-biphenylol | Drug Info | [529002] | |||
4'-(trifluoromethyl)-4-biphenylsulfonamide | Drug Info | [529002] | |||
4'-(trifluoromethyl)-4-biphenylyl carbamate | Drug Info | [529002] | |||
4'-(trifluoromethyl)-4-biphenylyl sulfamate | Drug Info | [529002] | |||
4'-trifluoromethyl-biphenyl-4-ylamine | Drug Info | [529002] | |||
4-(trifluoromethyl)biphenyl | Drug Info | [529002] | |||
6-fluoro-2-methyl-9H-carbazole | Drug Info | [530951] | |||
7-tert-butyl-9H-carbazole-3-carboxylic acid | Drug Info | [530951] | |||
9-methyl-2-(trifluoromethyl)-9H-carbazole | Drug Info | [530951] | |||
9H-carbazole-2-carbaldehyde | Drug Info | [530951] | |||
9H-carbazole-3-carbaldehyde | Drug Info | [530951] | |||
Adociasulfate-2 | Drug Info | [528349] | |||
EMD-534085 | Drug Info | [530716] | |||
Methyl 7-tert-butyl-9H-carbazole-3-carboxylate | Drug Info | [530951] | |||
Methyl 9H-carbazole-2-carboxylate | Drug Info | [530951] | |||
Methyl[4'-(trifluoromethyl)-4-biphenylyl]amine | Drug Info | [529002] | |||
N-(4'-bromo-3,3'-difluoro-4-biphenylyl)urea | Drug Info | [529002] | |||
N-(4'-chloro-4-biphenylyl)methanesulfonamide | Drug Info | [529002] | |||
N-(4'-isopropyl-4-biphenylyl)urea | Drug Info | [529002] | |||
N-(4'-methyl-4-biphenylyl)urea | Drug Info | [529002] | |||
N-(4'-t-butyl-4-biphenylyl)urea | Drug Info | [529002] | |||
N-[3'-(trifluoromethyl)-4-biphenylyl]urea | Drug Info | [529002] | |||
N-[4'-(ethylsulfonyl)-3-fluoro-4-biphenylyl]urea | Drug Info | [529002] | |||
N-[4'-(trifluoromethyl)-4-biphenylyl]sulfamide | Drug Info | [529002] | |||
N-[4'-(trifluoromethyl)-4-biphenylyl]thiourea | Drug Info | [529002] | |||
N-[4'-(trifluoromethyl)-4-biphenylyl]urea | Drug Info | [529002] | |||
N-[4-(1,3-benzodioxol-5-yl)phenyl]sulfamide | Drug Info | [529002] | |||
N-{4'-[(trifluoromethyl)sulfonyl]-4-biphenyl}urea | Drug Info | [529002] | |||
N-{4'-[(trifluoromethyl)thio]-4-biphenyl}urea | Drug Info | [529002] | |||
SB-731489 | Drug Info | [529002] | |||
Pathways | |||||
Reactome | MHC class II antigen presentation | ||||
Kinesins | |||||
WikiPathways | MHC class II antigen presentation | ||||
Kinesins | |||||
References | |||||
Ref 528349 | J Med Chem. 2006 Aug 10;49(16):4857-60.Inhibition of kinesin motor proteins by adociasulfate-2. | ||||
Ref 529002 | J Med Chem. 2007 Oct 4;50(20):4939-52. Epub 2007 Aug 29.Novel ATP-competitive kinesin spindle protein inhibitors. | ||||
Ref 530716 | Bioorg Med Chem Lett. 2010 Mar 1;20(5):1491-5. Epub 2010 Jan 25.The discovery and optimization of hexahydro-2H-pyrano[3,2-c]quinolines (HHPQs) as potent and selective inhibitors of the mitotic kinesin-5. | ||||
Ref 530951 | J Med Chem. 2010 Jul 8;53(13):5054-8.Kinesin spindle protein (KSP) inhibitors with 2,3-fused indole scaffolds. | ||||
Ref 531008 | J Med Chem. 2010 Aug 12;53(15):5676-83.Structural basis for inhibition of Eg5 by dihydropyrimidines: stereoselectivity of antimitotic inhibitors enastron, dimethylenastron and fluorastrol. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.