Target Regulator(s) Information (Transcription Factor)

Content Navigation (  All   None )                                      
Target General Information
The Transcription Factors (TFs) Regulating This Target
References
Target General Information  Top
Target ID T64205 Target Info
Target Name Signal transducer and activator of transcription 1 (STAT1)
Synonyms Transcription factor ISGF-3 components p91/p84; Signal transducers and activators of transcription factor; Signal transducer and activator of transcription 1-alpha/beta; STAT-1; P91
Target Type Patented-recorded Target
Gene Name STAT1
Biochemical Class Transcription factor
UniProt ID
STAT1_HUMAN
The Transcription Factors (TFs) Regulating This Target  Top
TF Name Interferon regulatory factor 1 (IRF1)
Classification Superclass Helix-turn-helix
Class Tryptophan clusters
Family Interferon-regulating factors
Regulation Mechanism Mutation of the GAAANN repeats within the IGI DNA element eliminated IRF1 binding and the IFN-regulated activity of the STAT1 intronic enhancer region. [1]
Evidence Score (E-score) 2 +
1 Electrophoretic Mobility Shift Assay, Reporter Assay [1]
2 Reporter Assay [2]
UniProt ID
IRF1_HUMAN
Sequence
MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAI
HTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQR
KERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALT
PALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKL
LEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKN
MDATWLDSLLTPVRLPSIQAIPCAP
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
CD antigens [+] 1 CD antigens Co-regulated By This TF +
1 Vascular cell adhesion protein 1 (VCAM1) Literature-reported Target Target Info [3]
Cytokines / Cytokine receptors [+] 1 Cytokines / Cytokine receptors Co-regulated By This TF +
1 Interleukin-12 beta (IL12B) Successful Target Target Info [4]
Transcription factors [+] 1 Transcription factors Co-regulated By This TF +
1 Signal transducer and activator of transcription 1 (STAT1) Patented-recorded Target Target Info [1]
TF Name Signal transducer and activator of transcription 1 (STAT1) homodimer
Classification Superclass beta-Scaffold Factors with Minor Groove Contacts
Class Signal transducer and activator of transcription
Family Signal transducer and activator of transcription
Regulation Mechanism IRF9 directs binding of ISGF3 to the core ISRE, and STAT1 stabilizes the interaction with DNA by recognizing and binding to STAT1 GA(A/T)TC half-sites flanking the core ISRE sequence. [1]
Evidence Score (E-score) 1 +
1 Electrophoretic Mobility Shift Assay, Reporter Assay [1]
UniProt ID
STAT1_HUMAN
Sequence
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQ
RFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNR
EHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWK
RRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQV
LWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLTPPCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFL
LRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTT
DNLLPMSPEEFDEVSRIVGSVEFDSMMNTV
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Cytokines / Cytokine receptors [+] 2 Cytokines / Cytokine receptors Co-regulated By This TF +
1 CD40L receptor (CD40) Clinical trial Target Target Info [5]
2 Interleukin 2 receptor alpha (IL2RA) Successful Target Target Info [6]
Immunoglobulins [+] 1 Immunoglobulins Co-regulated By This TF +
1 Intercellular adhesion molecule ICAM-1 (ICAM1) Successful Target Target Info [7]
Oxidoreductases [+] 1 Oxidoreductases Co-regulated By This TF +
1 NADPH oxidase 2 (CYBB) Literature-reported Target Target Info [8]
Transcription factors [+] 2 Transcription factors Co-regulated By This TF +
1 Interferon regulatory factor 1 (IRF1) Literature-reported Target Target Info [1]
2 Signal transducer and activator of transcription 1 (STAT1) Patented-recorded Target Target Info [1]
References  Top
REF 1 Isolation and characterization of a human STAT1 gene regulatory element. Inducibility by interferon (IFN) types I and II and role of IFN regulatory... J Biol Chem. 2002 May 31;277(22):19408-17.
REF 2 IRF1 supports DNA binding of STAT1 by promoting its phosphorylation. Immunol Cell Biol. 2018 Nov;96(10):1095-1103.
REF 3 Endothelial interferon regulatory factor 1 cooperates with NF-kappa B as a transcriptional activator of vascular cell adhesion molecule 1. Mol Cell Biol. 1995 May;15(5):2558-69.
REF 4 Identification and characterization of a novel Ets-2-related nuclear complex implicated in the activation of the human interleukin-12 p40 gene prom... J Biol Chem. 1997 Apr 18;272(16):10389-95.
REF 5 IL-4-activated STAT-6 inhibits IFN-gamma-induced CD40 gene expression in macrophages/microglia. J Immunol. 2000 Dec 1;165(11):6235-43.
REF 6 Interferon-alpha activates multiple STAT proteins and upregulates proliferation-associated IL-2Ralpha, c-myc, and pim-1 genes in human T cells. Blood. 1999 Mar 15;93(6):1980-91.
REF 7 Stat1 depends on transcriptional synergy with Sp1. J Biol Chem. 1995 Dec 22;270(51):30264-7.
REF 8 Cooperation of STAT-1 and IRF-1 in interferon-gamma-induced transcription of the gp91(phox) gene. J Biol Chem. 2002 Mar 15;277(11):9103-11.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.