Target Regulator(s) Information (Transcription Factor)

Content Navigation (  All   None )                                      
Target General Information
The Transcription Factors (TFs) Regulating This Target
References
Target General Information  Top
Target ID T75888 Target Info
Target Name Carnitine O-palmitoyltransferase I (CPT1B)
Synonyms KIAA1670; Carnitine palmitoyltransferase I-like protein; Carnitine palmitoyltransferase I; Carnitine palmitoyltransferase 1B; Carnitine palmitoyl-transferase I; Carnitine o-palmitoyltransferase-1; Carnitine O-palmitoyltransferase I, muscle isoform; Carnitine O-palmitoyltransferase 1, muscle isoform; CPTI-M; CPTI-L; CPT1-M; CPT-1; CPT I; CPT
Target Type Successful Target
Gene Name CPT1B
Biochemical Class Acyltransferase
UniProt ID
CPT1B_HUMAN
The Transcription Factors (TFs) Regulating This Target  Top
TF Name Retinoid X receptor alpha (RXR-A)
Classification Superclass Zinc-coordinating DNA-binding domains
Class Cys4 zinc finger of nuclear receptor type
Family Thyroid hormone receptor-like factors
Subfamily Retinoid X receptors
Regulation Type Increase
Regulation Mechanism PPAR-A/RXR-A formed specific complexes with oligonucleotides containing the FARE, and anti-PPAR-A antibody shifted nuclear protein-DNA complexes, confirming the role of this factor in regulating the expression of this critical metabolic enzyme gene. The constitutive repressor chicken ovalbumin upstream promoter transcription factor competitively binds at the FARE and modulates fatty acid induction of the promoters. [1]
Evidence Score (E-score) 2 +
1 Electrophoretic Mobility Shift Assay [1]
2 Electrophoretic Mobility Shift Assay [2]
UniProt ID
RXRA_HUMAN
Sequence
MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING
MGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP
AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID
KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL
AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL
LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM
QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Acyltransferases [+] 1 Acyltransferases Co-regulated By This TF +
1 Carnitine O-palmitoyltransferase I (CPT1B) Successful Target Target Info [1]
Apolipoproteins [+] 4 Apolipoproteins Co-regulated By This TF +
1 Apolipoprotein A-I (APOA1) Clinical trial Target Target Info [3]
2 Apolipoprotein A-II (APOA2) Literature-reported Target Target Info [4]
3 Apolipoprotein C-III (ApoCIII) Clinical trial Target Target Info [5]
4 Apolipoprotein E (APOE) Clinical trial Target Target Info [6]
Ester hydrolases [+] 1 Ester hydrolases Co-regulated By This TF +
1 Lipoprotein lipase (LPL) Successful Target Target Info [7]
G protein-coupled receptors [+] 1 G protein-coupled receptors Co-regulated By This TF +
1 Extracellular calcium-sensing receptor (CASR) Successful Target Target Info [8]
Glycoproteins [+] 2 Glycoproteins Co-regulated By This TF +
1 Cholesteryl ester transfer protein (CETP) Clinical trial Target Target Info [9]
2 Phospholipid transfer protein (PLTP) Literature-reported Target Target Info [10]
Kinases [+] 1 Kinases Co-regulated By This TF +
1 Epidermal growth factor receptor (EGFR) Successful Target Target Info [11]
Mitochondrial carriers [+] 1 Mitochondrial carriers Co-regulated By This TF +
1 Mitochondrial uncoupling protein 3 (UCP3) Clinical trial Target Target Info [12]
Nuclear hormone receptors [+] 4 Nuclear hormone receptors Co-regulated By This TF +
1 Hepatocyte nuclear factor 4-alpha (HNF4A) Literature-reported Target Target Info [13]
2 Retinoic acid receptor beta (RARB) Successful Target Target Info [14]
3 Retinoic acid receptor gamma (RARG) Successful Target Target Info [15]
4 Retinoic acid receptor RXR-gamma (RXRG) Successful Target Target Info [16]
TF Name Peroxisome proliferator-activated receptor alpha (PPAR-A)
Classification Superclass Zinc-coordinating DNA-binding domains
Class Cys4 zinc finger of nuclear receptor type
Family Thyroid hormone receptor-like factors
Subfamily Thyroid hormone receptors
Regulation Type Increase
Regulation Mechanism PPAR-A/RXR-A formed specific complexes with oligonucleotides containing the FARE, and anti-PPAR-A antibody shifted nuclear protein-DNA complexes, confirming the role of this factor in regulating the expression of this critical metabolic enzyme gene. The constitutive repressor chicken ovalbumin upstream promoter transcription factor competitively binds at the FARE and modulates fatty acid induction of the promoters. [1]
Evidence Score (E-score) 1 +
1 Electrophoretic Mobility Shift Assay [1]
UniProt ID
PPARA_HUMAN
Sequence
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSC
PGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFV
IHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANL
DLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDI
FLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Acyltransferases [+] 1 Acyltransferases Co-regulated By This TF +
1 Carnitine O-palmitoyltransferase I (CPT1B) Successful Target Target Info [1]
Apolipoproteins [+] 1 Apolipoproteins Co-regulated By This TF +
1 Apolipoprotein C-III (ApoCIII) Clinical trial Target Target Info [17]
References  Top
REF 1 Co-regulation of tissue-specific alternative human carnitine palmitoyltransferase Ibeta gene promoters by fatty acid enzyme substrate. J Biol Chem. 1998 Dec 4;273(49):32901-9.
REF 2 Hypoxia inhibits the peroxisome proliferator-activated receptor alpha/retinoid X receptor gene regulatory pathway in cardiac myocytes: a mechanism ... J Biol Chem. 2001 Jul 20;276(29):27605-12.
REF 3 Bile acid-activated nuclear receptor FXR suppresses apolipoprotein A-I transcription via a negative FXR response element. J Clin Invest. 2002 Apr;109(7):961-71.
REF 4 Retinoids increase human apolipoprotein A-11 expression through activation of the retinoid X receptor but not the retinoic acid receptor. Mol Cell Biol. 1996 Jul;16(7):3350-60.
REF 5 Mode of action of peroxisome proliferators as hypolipidemic drugs. Suppression of apolipoprotein C-III. J Biol Chem. 1995 Jun 2;270(22):13470-5.
REF 6 LXRs control lipid-inducible expression of the apolipoprotein E gene in macrophages and adipocytes. Proc Natl Acad Sci U S A. 2001 Jan 16;98(2):507-12.
REF 7 PPARalpha and PPARgamma activators direct a distinct tissue-specific transcriptional response via a PPRE in the lipoprotein lipase gene. EMBO J. 1996 Oct 1;15(19):5336-48.
REF 8 Human calcium-sensing receptor gene. Vitamin D response elements in promoters P1 and P2 confer transcriptional responsiveness to 1,25-dihydroxyvitamin D. J Biol Chem. 2002 Aug 16;277(33):30337-50.
REF 9 The orphan nuclear receptor LRH-1 potentiates the sterol-mediated induction of the human CETP gene by liver X receptor. J Biol Chem. 2001 Jul 6;276(27):24767-73.
REF 10 The farnesoid X-activated receptor mediates bile acid activation of phospholipid transfer protein gene expression. J Biol Chem. 2000 Dec 15;275(50):39313-7.
REF 11 T3 receptor suppression of Sp1-dependent transcription from the epidermal growth factor receptor promoter via overlapping DNA-binding sites. J Biol Chem. 1993 Jul 25;268(21):16065-73.
REF 12 The human uncoupling protein-3 gene promoter requires MyoD and is induced by retinoic acid in muscle cells. FASEB J. 2000 Nov;14(14):2141-3.
REF 13 Regulatory mechanisms controlling human hepatocyte nuclear factor 4alpha gene expression. Mol Cell Biol. 2001 Nov;21(21):7320-30.
REF 14 Vitamin D represses retinoic acid-dependent transactivation of the retinoic acid receptor-beta2 promoter: the AF-2 domain of the vitamin D receptor is required for transrepression. Endocrinology. 1999 Jun;140(6):2898-907.
REF 15 RAR gamma 2 expression is regulated through a retinoic acid response element embedded in Sp1 sites. Mol Cell Biol. 1992 Jul;12(7):2976-85.
REF 16 Identification of thyroid hormone response elements in the human fatty acid synthase promoter. Proc Natl Acad Sci U S A. 1998 Oct 13;95(21):12260-5.
REF 17 Binding specificity and modulation of the human ApoCIII promoter activity by heterodimers of ligand-dependent nuclear receptors. Biochemistry. 1999 Jan 19;38(3):964-75.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.