Target Regulator(s) Information (Transcription Factor)
Target General Information | Top | ||||
---|---|---|---|---|---|
Target ID | T78585 | Target Info | |||
Target Name | Interleukin-5 (IL5) | ||||
Synonyms | TRF protein; T-cell replacing factor; IL-5; Eosinophil differentiation factor; B-cell differentiation factor I; B cell differentiation factor I | ||||
Target Type | Successful Target | ||||
Gene Name | IL5 | ||||
Biochemical Class | Cytokine: interleukin | ||||
UniProt ID |
The Transcription Factors (TFs) Regulating This Target | Top | ||||
---|---|---|---|---|---|
TF Name | c-Jun/c-Jun (AP-1) homodimer | ||||
Classification | Superclass | Basic Domains | |||
Class | Leucine zipper factors (bZIP) | ||||
Family | AP-1(-like) components | ||||
Subfamily | Jun | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | The NFAT family of proteins have been reported to function in the IL promoter through cooperative interactions with proteins bound to downstream AP-1 sites. | [1] | |||
Evidence Score (E-score) | 2 | + | |||
1 | DNase I Footprint Analysis, Electrophoretic Mobility Shift Assay | [1] | |||
2 | Electrophoretic Mobility Shift Assay | [4] | |||
UniProt ID | |||||
Sequence |
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Cytokines / Cytokine receptors | [+] 2 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
1 | Interleukin 5 receptor alpha (IL5RA) | Successful Target | Target Info | [4] | |
2 | Interleukin-5 (IL5) | Successful Target | Target Info | [1] | |
Fibronectin proteins | [+] 1 Fibronectin proteins Co-regulated By This TF | + | |||
1 | Fibronectin (FN1) | Clinical trial Target | Target Info | [6] | |
Lipoprotein receptors | [+] 1 Lipoprotein receptors Co-regulated By This TF | + | |||
1 | Low-density lipoprotein receptor (LDL-R) | Successful Target | Target Info | [7] | |
Peptidases | [+] 2 Peptidases Co-regulated By This TF | + | |||
1 | Matrix metalloproteinase-1 (MMP-1) | Successful Target | Target Info | [8] | |
2 | Matrix metalloproteinase-9 (MMP-9) | Clinical trial Target | Target Info | [9] | |
TF Name | GATA-binding factor 3 (GATA-3) | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | diverse Cys4 zinc fingers | ||||
Family | GATA-Factors | ||||
Subfamily | vertebral GATA-Factors | ||||
Regulation Mechanism | GATA-3 binds to three sites in the human IL5 promoter in the human T-cell line PER117. | [2] | |||
Evidence Score (E-score) | 2 | + | |||
1 | DNase I Footprint Analysis, Electrophoretic Mobility Shift Assay | [2] | |||
2 | Electrophoretic Mobility Shift Assay | [5] | |||
UniProt ID | |||||
Sequence |
MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHV
PPYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKT SIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDE KECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPYVPEYSSGLFPPSSLL GGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPL IKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEG IQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPT PMHPPSSLSFGPHHPSSMVTAMG |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Cytokines / Cytokine receptors | [+] 2 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
1 | Interferon-gamma (IFNG) | Successful Target | Target Info | [10] | |
2 | Interleukin-5 (IL5) | Successful Target | Target Info | [2] | |
G protein-coupled receptors | [+] 1 G protein-coupled receptors Co-regulated By This TF | + | |||
1 | Gonadotropin-releasing hormone receptor (GNRHR) | Successful Target | Target Info | [11] | |
Oxidoreductases | [+] 1 Oxidoreductases Co-regulated By This TF | + | |||
1 | Estradiol 17 beta-dehydrogenase 1 (17-beta-HSD1) | Clinical trial Target | Target Info | [12] | |
TF Name | Nuclear factor of activated T-cells 1 (NF-ATc1) | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | diverse Cys4 zinc fingers | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | Corresponding binding activities were detected to be present in nuclear extracts from the mouse mast cell line by defined NF-AT and GATA binding sites as probes for a gel shift analysis. Competition analysis, in combination with probes from the human IL5 promoter, confirmed that these factors indeed bind to the consensus sequences identified by computer analysis. | [3] | |||
Evidence Score (E-score) | 1 | + | |||
1 | Electrophoretic Mobility Shift Assay | [3] | |||
UniProt ID | |||||
Sequence |
MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASSNVSPALPLPT
AHSTLPAPCHNLQTSTPGIIPPADHPSGYGAALDGGPAGYFLSSGHTRPDGAPALESPRI EITSCLGLYHNNNQFFHDVEVEDVLPSSKRSPSTATLSLPSLEAYRDPSCLSPASSLSSR SCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPST SPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSW LGNTTQYTSSAIVAAINALTTDSSLDLGDGVPVKSRKTTLEQPPSVALKVEPVGEDLGSP PPPADFAPEDYSSFQHIRKGGFCDQYLAVPQHPYQWAKPKPLSPTSYMSPTLPALDWQLP SHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGT ADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLR NSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEK QSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEI PPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANVPIIKTEPTDDYEPAPTCGPVSQ GLSPLPRPYYSQQLAMPPDPSSCLVAGFPPCPQRSTLMPAAPGVSPKLHDLSPAAYTKGV ASPGHCHLGLPQPAGEAPAVQDVPRPVATHPGSPGQPPPALLPQQVSAPPSSSCPPGLEH SLCPSSPSPPLPPATQEPTCLQPCSPACPPATGRPQHLPSTVRRDESPTAGPRLLPEVHE DGSPNLAPIPVTVKREPEELDQLYLDDVNEIIRNDLSSTSTHS |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Cytokines / Cytokine receptors | [+] 2 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
1 | Interleukin-4 (IL4) | Clinical trial Target | Target Info | [13] | |
2 | Interleukin-5 (IL5) | Successful Target | Target Info | [3] | |
TF Name | Nuclear factor of activated T-cells 2 (NF-ATc2) | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | diverse Cys4 zinc fingers | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | Corresponding binding activities were detected to be present in nuclear extracts from the mouse mast cell line by defined NF-AT and GATA binding sites as probes for a gel shift analysis. Competition analysis, in combination with probes from the human IL5 promoter, confirmed that these factors indeed bind to the consensus sequences identified by computer analysis. | [3] | |||
Evidence Score (E-score) | 1 | + | |||
1 | Electrophoretic Mobility Shift Assay | [3] | |||
UniProt ID | |||||
Sequence |
MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNEEEPNAHKVASPPSGPAY
PDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHE LIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFIS DTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPR PASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGS AVIMDALNSLATDSPCGIPPKMWKTSPDPSPVSAAPSKAGLPRHIYPAVEFLGPCEQGER RNSAPESILLVPPTWPKPLVPAIPICSIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHH RAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRIT GKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNT RVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTG QNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYV INGKRKRSQPQHFTYHPVPAIKTEPTDEYDPTLICSPTHGGLGSQPYYPQHPMVAESPSC LVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADA HRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPG TTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNL DQTYLDDVNEIIRKEFSGPPARNQT |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Cytokines / Cytokine receptors | [+] 2 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
1 | Interleukin-4 (IL4) | Clinical trial Target | Target Info | [13] | |
2 | Interleukin-5 (IL5) | Successful Target | Target Info | [3] |
References | Top | ||||
---|---|---|---|---|---|
REF 1 | Identification of transcription factor binding sites important in the regulation of the human interleukin-5 gene. J Biol Chem. 1997 Jun 27;272(26):16453-65. | ||||
REF 2 | GATA-3 has dual regulatory functions in human interleukin-5 transcription. J Biol Chem. 2001 Dec 21;276(51):48502-9. | ||||
REF 3 | A nuclear factor of activated T cell-like transcription factor in mast cells is involved in IL-5 gene regulation after IgE plus antigen stimulation. J Immunol. 1995 Jun 1;154(11):6112-9. | ||||
REF 4 | An AP-1 site in the promoter of the human IL-5R alpha gene is necessary for promoter activity in eosinophilic HL60 cells. FEBS Lett. 1998 Sep 4;434(3):251-4. | ||||
REF 5 | Cyclic AMP-induced chromatin changes support the NFATc-mediated recruitment of GATA-3 to the interleukin 5 promoter. J Biol Chem. 2008 Nov 7;283(45):31030-7. | ||||
REF 6 | Cyclic AMP inhibits fibronectin gene expression in a newly developed granulosa cell line by a mechanism that suppresses cAMP-responsive element-dependent transcriptional activation. J Biol Chem. 1990 Oct 25;265(30):18219-26. | ||||
REF 7 | Identification of a novel sterol-independent regulatory element in the human low density lipoprotein receptor promoter. J Biol Chem. 2000 Feb 18;275(7):5214-21. | ||||
REF 8 | Phorbol ester-inducible genes contain a common cis element recognized by a TPA-modulated trans-acting factor. Cell. 1987 Jun 19;49(6):729-39. | ||||
REF 9 | Stimulation of 92-kDa gelatinase B promoter activity by ras is mitogen-activated protein kinase kinase 1-independent and requires multiple transcription factor binding sites including closely spaced PEA3/ets and AP-1 sequences. J Biol Chem. 1996 May 3;271(18):10672-80. | ||||
REF 10 | Two essential regulatory elements in the human interferon gamma promoter confer activation specific expression in T cells. J Exp Med. 1993 Nov 1;178(5):1483-96. | ||||
REF 11 | Functional mapping of a placenta-specific upstream promoter for human gonadotropin-releasing hormone receptor gene. Endocrinology. 2001 Apr;142(4):1506-16. | ||||
REF 12 | The proximal promoter region of the gene encoding human 17beta-hydroxysteroid dehydrogenase type 1 contains GATA, AP-2, and Sp1 response elements: analysis of promoter function in choriocarcinoma cells. Endocrinology. 1997 Aug;138(8):3417-25. | ||||
REF 13 | Inhibition of NF-AT-dependent transcription by NF-kappa B: implications for differential gene expression in T helper cell subsets. Proc Natl Acad Sci U S A. 1995 Dec 5;92(25):11623-7. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.