Target Regulator(s) Information (Transcription Factor)
| Target General Information | Top | ||||
|---|---|---|---|---|---|
| Target ID | T96627 | Target Info | |||
| Target Name | C-X-C motif chemokine 2 (CXCL2) | ||||
| Synonyms | SCYB2; Macrophage inflammatory protein 2-alpha; MIP2A; MIP2-alpha; Growth-regulated protein beta; Growth regulatedprotein beta; Gro-beta; GROB; GRO2 | ||||
| Target Type | Clinical trial Target | ||||
| Gene Name | CXCL2 | ||||
| Biochemical Class | Cytokine: CXC chemokine | ||||
| UniProt ID | |||||
| The Transcription Factors (TFs) Regulating This Target | Top | ||||
|---|---|---|---|---|---|
| TF Name | NF-kappa-B (NFKB) homo/heterodimer | ||||
| Classification | Superclass | beta-Scaffold Factors with Minor Groove Contacts | |||
| Class | RHR (Rel homology region) | ||||
| Evidence Score (E-score) | 1 | + | |||
| 1 | Electrophoretic Mobility Shift Assay, Chloramphenicol Acetyltransferase Assay | [1] | |||
| UniProt ID | |||||
| Sequence |
MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV
CEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCED GICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQA EGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDF SPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFH PGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGE VTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQD ENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVED LLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMM SNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGT TPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMAT SWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLG LGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQ AHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQ EGPLEGKI |
||||
| The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
| Cytokines / Cytokine receptors | [+] 5 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
| 1 | C-X-C motif chemokine 1 (CXCL1) | Literature-reported Target | Target Info | [2] | |
| 2 | C-X-C motif chemokine 2 (CXCL2) | Clinical trial Target | Target Info | [1] | |
| 3 | Interleukin 2 receptor alpha (IL2RA) | Successful Target | Target Info | [3] | |
| 4 | Interleukin-4 (IL4) | Clinical trial Target | Target Info | [4] | |
| 5 | Interleukin-8 (IL8) | Successful Target | Target Info | [5] | |
| Glycoproteins | [+] 1 Glycoproteins Co-regulated By This TF | + | |||
| 1 | E-selectin (SELE) | Clinical trial Target | Target Info | [6] | |
| Immunoglobulins | [+] 1 Immunoglobulins Co-regulated By This TF | + | |||
| 1 | Intercellular adhesion molecule ICAM-1 (ICAM1) | Successful Target | Target Info | [7] | |
| Transcription factors | [+] 1 Transcription factors Co-regulated By This TF | + | |||
| 1 | Cellular tumor antigen p53 (TP53) | Clinical trial Target | Target Info | [8] | |
| References | Top | ||||
|---|---|---|---|---|---|
| REF 1 | An NF-kappa B-like transcription factor mediates IL-1/TNF-alpha induction of gro in human fibroblasts. J Immunol. 1991 Jul 15;147(2):520-7. | ||||
| REF 2 | HMGI(Y) and Sp1 in addition to NF-kappa B regulate transcription of the MGSA/GRO alpha gene. Nucleic Acids Res. 1995 Oct 25;23(20):4210-9. | ||||
| REF 3 | Regulation of cell-type-specific interleukin-2 receptor alpha-chain gene expression: potential role of physical interactions between Elf-1, HMG-I(Y... Mol Cell Biol. 1995 Mar;15(3):1786-96. | ||||
| REF 4 | Inhibition of NF-AT-dependent transcription by NF-kappa B: implications for differential gene expression in T helper cell subsets. Proc Natl Acad Sci U S A. 1995 Dec 5;92(25):11623-7. | ||||
| REF 5 | Cooperation between transcription factor AP-1 and NF-kappaB in the induction of interleukin-8 in human pancreatic adenocarcinoma cells by hypoxia. J Interferon Cytokine Res. 1999 Dec;19(12):1363-71. | ||||
| REF 6 | Interleukin-4 suppression of tumor necrosis factor alpha-stimulated E-selectin gene transcription is mediated by STAT6 antagonism of NF-kappaB. J Biol Chem. 1997 Apr 11;272(15):10212-9. | ||||
| REF 7 | Flanking sequences for the human intercellular adhesion molecule-1 NF-kappaB response element are necessary for tumor necrosis factor alpha-induced gene expression. J Biol Chem. 1997 Jun 20;272(25):15928-35. | ||||
| REF 8 | Additive effect between NF-kappaB subunits and p53 protein for transcriptional activation of human p53 promoter. Oncogene. 2000 Sep 28;19(41):4787-94. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.