Target Information

Target General Information

Top

Target ID

T36121 (Former ID: TTDC00271)

Target Name

Proto-oncogene c-Myc (MYC)

Synonyms

Transcription factor p64; Myc proto-oncogene protein; Class E basic helix-loop-helix protein 39; BHLHE39

Click to Show/Hide

Gene Name

MYC

Target Type

Literature-reported target

[1]

Function

Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'. Activates the transcription of growth-related genes. Binds to the VEGFA promoter, promoting VEGFA production and subsequent sprouting angiogenesis.

Click to Show/Hide

UniProt ID

MYC_HUMAN

Sequence

MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQD
LSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLL
RKRREQLKHKLEQLRNSCA

Click to Show/Hide

3D Structure

Click to Show 3D Structure of This Target

AlphaFold

HIT2.0 ID

T26EZU

Cell-based Target Expression Variations

Top

Cell-based Target Expression Variations

Cell-based Target Expression Variations Info

Different Human System Profiles of Target	Top
Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target. A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020). Human Pathway Affiliation of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function. Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes (Pharmacol Rev, 58: 259-279, 2006). Biological Network Descriptors of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database. The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information (Front Pharmacol, 9, 1245, 2018; Curr Opin Struct Biol. 44:134-142, 2017). Human Similarity Proteins Human Pathway Affiliation Biological Network Descriptors

Different Human System Profiles of Target

Top

Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.

A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020).

Human Pathway Affiliation of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.

Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes (Pharmacol Rev, 58: 259-279, 2006).

Biological Network Descriptors of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.

The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information (Front Pharmacol, 9, 1245, 2018; Curr Opin Struct Biol. 44:134-142, 2017).

Human Similarity Proteins

Human Pathway Affiliation

Biological Network Descriptors

There is no similarity protein (E value < 0.005) for this target

KEGG Pathway	Pathway ID	Affiliated Target
MAPK signaling pathway	hsa04010	Affiliated Target
Class: Environmental Information Processing => Signal transduction	Pathway Hierarchy
ErbB signaling pathway	hsa04012	Affiliated Target
Class: Environmental Information Processing => Signal transduction	Pathway Hierarchy
Cell cycle	hsa04110	Affiliated Target
Class: Cellular Processes => Cell growth and death	Pathway Hierarchy
PI3K-Akt signaling pathway	hsa04151	Affiliated Target
Class: Environmental Information Processing => Signal transduction	Pathway Hierarchy
Cellular senescence	hsa04218	Affiliated Target
Class: Cellular Processes => Cell growth and death	Pathway Hierarchy
Wnt signaling pathway	hsa04310	Affiliated Target
Class: Environmental Information Processing => Signal transduction	Pathway Hierarchy
TGF-beta signaling pathway	hsa04350	Affiliated Target
Class: Environmental Information Processing => Signal transduction	Pathway Hierarchy
Hippo signaling pathway	hsa04390	Affiliated Target
Class: Environmental Information Processing => Signal transduction	Pathway Hierarchy
Signaling pathways regulating pluripotency of stem cells	hsa04550	Affiliated Target
Class: Cellular Processes => Cellular community - eukaryotes	Pathway Hierarchy
JAK-STAT signaling pathway	hsa04630	Affiliated Target
Class: Environmental Information Processing => Signal transduction	Pathway Hierarchy
Thyroid hormone signaling pathway	hsa04919	Affiliated Target
Class: Organismal Systems => Endocrine system	Pathway Hierarchy
Click to Show/Hide the Information of Affiliated Human Pathways

Degree	107	Degree centrality	1.15E-02	Betweenness centrality	1.80E-02
Closeness centrality	2.84E-01	Radiality	1.48E+01	Clustering coefficient	8.38E-02
Neighborhood connectivity	4.26E+01	Topological coefficient	2.33E-02	Eccentricity	10
Download	Click to Download the Full PPI Network of This Target

Chemical Structure based Activity Landscape of Target

Top

Target Poor or Non Binders

Top

Target Poor or Non Binders

Target Poor or Non Binders Info

Target Regulators

Top

Target-regulating microRNAs

Target-regulating microRNAs Info

Target-interacting Proteins

Target-interacting Proteins Info

Target Profiles in Patients

Top

Target Expression
Profile (TEP)

Target Expression Profile Info

Target Affiliated Biological Pathways		Top
KEGG Pathway	[+] 25 KEGG Pathways	+
1	MAPK signaling pathway
2	ErbB signaling pathway
3	Cell cycle
4	PI3K-Akt signaling pathway
5	Wnt signaling pathway
6	TGF-beta signaling pathway
7	Hippo signaling pathway
8	Signaling pathways regulating pluripotency of stem cells
9	Jak-STAT signaling pathway
10	Thyroid hormone signaling pathway
11	Hepatitis B
12	HTLV-I infection
13	Epstein-Barr virus infection
14	Pathways in cancer
15	Transcriptional misregulation in cancer
16	Proteoglycans in cancer
17	MicroRNAs in cancer
18	Colorectal cancer
19	Endometrial cancer
20	Thyroid cancer
21	Bladder cancer
22	Chronic myeloid leukemia
23	Acute myeloid leukemia
24	Small cell lung cancer
25	Central carbon metabolism in cancer
NetPath Pathway	[+] 9 NetPath Pathways	+
1	IL9 Signaling Pathway
2	TCR Signaling Pathway
3	IL2 Signaling Pathway
4	IL4 Signaling Pathway
5	EGFR1 Signaling Pathway
6	TGF_beta_Receptor Signaling Pathway
7	Notch Signaling Pathway
8	Wnt Signaling Pathway
9	TSH Signaling Pathway
Panther Pathway	[+] 6 Panther Pathways	+
1	Interleukin signaling pathway
2	Oxidative stress response
3	PDGF signaling pathway
4	Wnt signaling pathway
5	p53 pathway feedback loops 2
6	CCKR signaling map ST
PID Pathway	[+] 22 PID Pathways	+
1	Regulation of nuclear SMAD2/3 signaling
2	Notch signaling pathway
3	p73 transcription factor network
4	E2F transcription factor network
5	CD40/CD40L signaling
6	Validated targets of C-MYC transcriptional activation
7	Presenilin action in Notch and Wnt signaling
8	LKB1 signaling events
9	Regulation of Telomerase
10	IL2-mediated signaling events
11	C-MYC pathway
12	IL2 signaling events mediated by PI3K
13	Ceramide signaling pathway
14	AP-1 transcription factor network
15	FOXM1 transcription factor network
16	IL6-mediated signaling events
17	PDGFR-beta signaling pathway
18	C-MYB transcription factor network
19	Validated nuclear estrogen receptor alpha network
20	Regulation of nuclear beta catenin signaling and target gene transcription
21	IL2 signaling events mediated by STAT5
22	Validated targets of C-MYC transcriptional repression
Reactome	[+] 8 Reactome Pathways	+
1	NOTCH1 Intracellular Domain Regulates Transcription
2	SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
3	Constitutive Signaling by NOTCH1 PEST Domain Mutants
4	Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
5	Binding of TCF/LEF:CTNNB1 to target gene promoters
6	MAPK6/MAPK4 signaling
7	Cyclin E associated events during G1/S transition
8	Cyclin A:Cdk2-associated events at S phase entry
WikiPathways	[+] 43 WikiPathways	+
1	DNA Damage Response (only ATM dependent)
2	DNA Damage Response
3	ErbB Signaling Pathway
4	Notch Signaling Pathway
5	IL-2 Signaling Pathway
6	G1 to S cell cycle control
7	Wnt Signaling Pathway
8	p38 MAPK Signaling Pathway
9	Wnt Signaling Pathway and Pluripotency
10	MAPK Signaling Pathway
11	TGF beta Signaling Pathway
12	Wnt Signaling Pathway Netpath
13	PPAR Alpha Pathway
14	Ectoderm Differentiation
15	Hair Follicle Development: Organogenesis (Part 2 of 3)
16	Bladder Cancer
17	Mammary gland development pathway - Involution (Stage 4 of 4)
18	Hair Follicle Development: Induction (Part 1 of 3)
19	S Phase
20	Transcriptional activity of SMAD2/SMAD3:SMAD4 heterotrimer
21	Signaling by NOTCH1
22	Structural Pathway of Interleukin 1 (IL-1)
23	Aryl Hydrocarbon Receptor
24	Polycystic Kidney Disease Pathway
25	Apoptosis
26	Retinoblastoma (RB) in Cancer
27	Spinal Cord Injury
28	Integrated Pancreatic Cancer Pathway
29	Gastric cancer network 2
30	B Cell Receptor Signaling Pathway
31	Prostate Cancer
32	Metastatic brain tumor
33	TSLP Signaling Pathway
34	Neural Crest Differentiation
35	IL-7 Signaling Pathway
36	TSH signaling pathway
37	Integrated Breast Cancer Pathway
38	Integrated Cancer pathway
39	Mitotic G1-G1/S phases
40	TP53 Network
41	miRNAs involved in DNA damage response
42	miRNA Regulation of DNA Damage Response
43	IL-5 Signaling Pathway

Target-Related Models and Studies

Top

Target Validation

Target Validation Info

References

Top

REF 1

Diversity-oriented synthesis: exploring the intersections between chemistry and biology. Nat Chem Biol. 2005 Jul;1(2):74-84.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Prof. Yuzong CHEN

Prof. Feng ZHU