Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T03644
|
||||
Former ID |
TTDI02186
|
||||
Target Name |
Alpha-synuclein
|
||||
Gene Name |
SNCA
|
||||
Synonyms |
NACP; NonA beta component of AD amyloid; NonA4 component of amyloid precursor; SNCA
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Alzheimer disease [ICD9: 331; ICD10: G30] | ||||
Parkinson's disease [ICD9: 332; ICD10: G20] | |||||
Function |
May be involved in the regulation of dopamine release and transport. Induces fibrillization of microtubule-associated protein tau. Reduces neuronal responsiveness to various apoptotic stimuli, leading to a decreased caspase-3 activation.
|
||||
BioChemical Class |
Synuclein family
|
||||
UniProt ID | |||||
Sequence |
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP DNEAYEMPSEEGYQDYEPEA |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Alzheimer' | ||||
s disease | |||||
Parkinson' | |||||
NetPath Pathway | Leptin Signaling Pathway | ||||
RANKL Signaling Pathway | |||||
PANTHER Pathway | Parkinson disease | ||||
Pathway Interaction Database | Alpha-synuclein signaling | ||||
Reactome | Amyloid formation | ||||
WikiPathways | Ectoderm Differentiation | ||||
Parkinsons Disease Pathway | |||||
Parkin-Ubiquitin Proteasomal System pathway | |||||
Alzheimers Disease | |||||
References | |||||
Ref 544219 | alpha-Synuclein in Parkinson's Disease. Cold Spring Harb Perspect Med. 2012 February; 2(2): a009399. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.