Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T10897
|
||||
Former ID |
TTDS00516
|
||||
Target Name |
Acyl-CoA desaturase
|
||||
Gene Name |
SCD
|
||||
Synonyms |
9 stearoyl-desaturase; Delta(9)-desaturase; Delta-9-stearoyl desaturase; Des A3; DesA3; Fatty acid desaturase; Membrane-bound 9 desaturase; Stearoyl-CoA desaturase; Stearoyl-coenzyme A (Delta9) desaturase; SCD
|
||||
Target Type |
Successful
|
||||
Disease | Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99] | ||||
Diabetes [ICD9: 253.5, 588.1; ICD10: E23.2, N25.1] | |||||
Lipid metabolism disorder [ICD10: E75-E78] | |||||
Type 2 diabetes [ICD9: 250; ICD10: E11] | |||||
Function |
Desaturates stearoyl-CoA to form oleoyl-CoA.
|
||||
BioChemical Class |
Oxidoreductases acting on paired donors
|
||||
Target Validation |
T10897
|
||||
UniProt ID | |||||
EC Number |
EC 1.14.19.1
|
||||
Sequence |
MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYK
DKEGPSPKVEYVWRNIILMSLLHLGALYGITLIPTCKFYTWLWGVFYYFVSALGITAGAH RLWSHRSYKARLPLRLFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFS HVGWLLVRKHPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWGE TFQNSVFVATFLRYAVVLNATWLVNSAAHLFGYRPYDKNISPRENILVSLGAVGEGFHNY HHSFPYDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKAAILARIKRTGDGNYKSG |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Metabolic pathways | ||||
References | |||||
Ref 522582 | ClinicalTrials.gov (NCT00846391) A Study to Assess the Safety and Efficacy of MK8245 in Patients With Type 2 Diabetes Mellitus and Inadequate Glycemic Control (MK8245-005 AM2). U.S. National Institutes of Health. | ||||
Ref 530248 | Bioorg Med Chem Lett. 2009 Aug 1;19(15):4070-4. Epub 2009 Jun 13.Potent, orally bioavailable, liver-selective stearoyl-CoA desaturase (SCD) inhibitors. | ||||
Ref 530276 | Bioorg Med Chem Lett. 2009 Sep 1;19(17):5214-7. Epub 2009 Jul 9.Thiazole analog as stearoyl-CoA desaturase 1 inhibitor. | ||||
Ref 530690 | Bioorg Med Chem Lett. 2010 Mar 1;20(5):1593-7. Epub 2010 Jan 21.SAR and optimization of thiazole analogs as potent stearoyl-CoA desaturase inhibitors. | ||||
Ref 531248 | Fatty acid bile acid conjugate inhibits hepatic stearoyl coenzyme A desaturase and is non-atherogenic. Arch Med Res. 2010 Aug;41(6):397-404. | ||||
Ref 531508 | Development of a liver-targeted stearoyl-CoA desaturase (SCD) inhibitor (MK-8245) to establish a therapeutic window for the treatment of diabetes and dyslipidemia. J Med Chem. 2011 Jul 28;54(14):5082-96. | ||||
Ref 532774 | The fatty acid-bile acid conjugate Aramchol reduces liver fat content in patients with nonalcoholic fatty liver disease. Clin Gastroenterol Hepatol. 2014 Dec;12(12):2085-91.e1. | ||||
Ref 535853 | Unique mechanism of action of the thiourea drug isoxyl on Mycobacterium tuberculosis. J Biol Chem. 2003 Dec 26;278(52):53123-30. Epub 2003 Oct 14. | ||||
Ref 536854 | Has nature already identified all useful antibacterial targets? Curr Opin Microbiol. 2008 Oct;11(5):387-92. Epub 2008 Oct 6. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.